(data stored in ACNUC7421 zone)

EMBL: CP000031.PE529

CP000031.PE529       Location/Qualifiers
FT   CDS             complement(532846..533271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0537"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93854"
FT                   /db_xref="GOA:Q5LW06"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW06"
FT                   /protein_id="AAV93854.1"
FT                   /translation="MTPPEAPTDGTASPGEMPPAVSVCASSGISVLRKRSDFLKAARAR
FT                   RQGAGSMMVQARKRDAGEAEGIRVGFTCSKKVGNAVARNRAKRRLREAARLVLPDMGRP
FT                   GWDYVLIGRPSDTASRPFDGLLDDLRRALRKLHAPKP"
     MTPPEAPTDG TASPGEMPPA VSVCASSGIS VLRKRSDFLK AARARRQGAG SMMVQARKRD        60
     AGEAEGIRVG FTCSKKVGNA VARNRAKRRL REAARLVLPD MGRPGWDYVL IGRPSDTASR       120
     PFDGLLDDLR RALRKLHAPK P                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page