(data stored in ACNUC7421 zone)

EMBL: CP000031.PE53

CP000031.PE53        Location/Qualifiers
FT   CDS             52706..53482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0053"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93384"
FT                   /db_xref="GOA:Q5LWK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK4"
FT                   /protein_id="AAV93384.1"
FT                   /translation="MSGRAAQDAAGGCAMTRWLPAVAATLFALAIWQAVVSLTDLPRFI
FT                   LPGPVLVAETWWQSRWLIAEHTAVTALEVLIGLACGAVLGVATALQLASSRIARVLVQP
FT                   MLVFTQALPVFALAPILTLWLGYGLWSKVAMAVLIIYFPITAAFFDGLMRTPVGYLDLA
FT                   RTMQASPRAVLWHIRVPAALPQLASGLRLAAVYAPIGAVIGEWVGASKGLGYLMLLANG
FT                   RAKTDLMFAAMLTLGVLSVLLHLAMRRATRRMAGER"
     MSGRAAQDAA GGCAMTRWLP AVAATLFALA IWQAVVSLTD LPRFILPGPV LVAETWWQSR        60
     WLIAEHTAVT ALEVLIGLAC GAVLGVATAL QLASSRIARV LVQPMLVFTQ ALPVFALAPI       120
     LTLWLGYGLW SKVAMAVLII YFPITAAFFD GLMRTPVGYL DLARTMQASP RAVLWHIRVP       180
     AALPQLASGL RLAAVYAPIG AVIGEWVGAS KGLGYLMLLA NGRAKTDLMF AAMLTLGVLS       240
     VLLHLAMRRA TRRMAGER                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page