(data stored in ACNUC7421 zone)

EMBL: CP000031.PE531

CP000031.PE531       Location/Qualifiers
FT   CDS             533672..534469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0539"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93856"
FT                   /db_xref="GOA:Q5LW04"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW04"
FT                   /protein_id="AAV93856.1"
FT                   /translation="MAAWVCILGQMKPDPETKPDPMRQTAQPAPQRLLRHLPLIVIVLI
FT                   AVIGAITLRDYLSFDTLAANRQALLAYREAHYAALAAIFVATYVLIVAFSLPGAAVASM
FT                   TGGFLFGLAVGTVLNVVAATIGAVAIFLAARAGLGAMLTARLEASEGTVKRLKEGLRRN
FT                   EIEVLFLLRLVPAVPFFAANLIPALVGVKLRNYVLTTALGIVPGAIVFTWIGVGLGGVF
FT                   DRGESPDLSLFREPFVIGPILGLCLLAALPIAIKALRGKPEGE"
     MAAWVCILGQ MKPDPETKPD PMRQTAQPAP QRLLRHLPLI VIVLIAVIGA ITLRDYLSFD        60
     TLAANRQALL AYREAHYAAL AAIFVATYVL IVAFSLPGAA VASMTGGFLF GLAVGTVLNV       120
     VAATIGAVAI FLAARAGLGA MLTARLEASE GTVKRLKEGL RRNEIEVLFL LRLVPAVPFF       180
     AANLIPALVG VKLRNYVLTT ALGIVPGAIV FTWIGVGLGG VFDRGESPDL SLFREPFVIG       240
     PILGLCLLAA LPIAIKALRG KPEGE                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page