(data stored in ACNUC7421 zone)

EMBL: CP000031.PE533

CP000031.PE533       Location/Qualifiers
FT   CDS             535901..537286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0541"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93858"
FT                   /db_xref="GOA:Q5LW02"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW02"
FT                   /protein_id="AAV93858.1"
FT                   /translation="MLNSLSGRFLILTVAFVMLAEVLIFVPSIARFRQDFLQNRLERAQ
FT                   IASLALLADDMLATDLETELLENAGVYNVVLRRDEVRQLMLSSPIPGQIGQSYDLRQAS
FT                   PWILMRDALLRFFMSENEVIRVIGEPVKEAGLLIEVTMDSQPLRMAMIDYGARILLLSL
FT                   VISIITAFFLFLAVRAILVRPIRGVVDYMQRYARAPEDVRGIITPNSGVTELREAEEAL
FT                   QMLQRQLTQALRQRERLAQLGGAVAKVSHDLRNILTSAQLFTDRIETSEDPLVRRMAPK
FT                   LVNSITRAVSLCESTLAFGRAEEPSPMLTMVRLHMVAEDVVASERLALGEGAIEIVNEV
FT                   PETLSARADPEQLFRVVMNLVRNARQALEATGQAGLVAVSGHETEADWVIEVRDTGPGL
FT                   PLKARENLFTPFQGGVRKGGSGLGLAISAELVRGHGGALVLKDSGPSGTAFEIRLPKGG
FT                   ETF"
     MLNSLSGRFL ILTVAFVMLA EVLIFVPSIA RFRQDFLQNR LERAQIASLA LLADDMLATD        60
     LETELLENAG VYNVVLRRDE VRQLMLSSPI PGQIGQSYDL RQASPWILMR DALLRFFMSE       120
     NEVIRVIGEP VKEAGLLIEV TMDSQPLRMA MIDYGARILL LSLVISIITA FFLFLAVRAI       180
     LVRPIRGVVD YMQRYARAPE DVRGIITPNS GVTELREAEE ALQMLQRQLT QALRQRERLA       240
     QLGGAVAKVS HDLRNILTSA QLFTDRIETS EDPLVRRMAP KLVNSITRAV SLCESTLAFG       300
     RAEEPSPMLT MVRLHMVAED VVASERLALG EGAIEIVNEV PETLSARADP EQLFRVVMNL       360
     VRNARQALEA TGQAGLVAVS GHETEADWVI EVRDTGPGLP LKARENLFTP FQGGVRKGGS       420
     GLGLAISAEL VRGHGGALVL KDSGPSGTAF EIRLPKGGET F                           461
//

If you have problems or comments...

PBIL Back to PBIL home page