(data stored in ACNUC9435 zone)

EMBL: CP000031.PE534

CP000031.PE534       Location/Qualifiers
FT   CDS             complement(537802..539055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD14035.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93859"
FT                   /db_xref="GOA:Q5LW01"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW01"
FT                   /protein_id="AAV93859.1"
FT                   /translation="MNTAQPDFDLIVAGAGMVGMSAALYAQMDGLKVALCDPNPPGSGT
FT                   TYGSACTIATYACIPVNSPAIFAALPYLLTSKDSPLSFNLLHGLKNPCWMLSFLANCRA
FT                   ARVRRITEALGRFLADADAGLDPLIMAAGAEDLIVSNDCLYVWSTRAGYEGARASNALR
FT                   RAQGVRFEELGPDEVRAMEPNLKQPIHRGLHFKGARHVTSPQALVGRMQHRFETLGGTY
FT                   LPARVERCDPDEGGVTVRLNDGGTLRAGHFALTAGARSRQIAGTGAEGLPLGTERGYHI
FT                   LYRDHASLVSRPVGWAEAGFYATPMAQGLRIAGTVEINAIDAPFNTKRTDYLQRKSHEM
FT                   FGQLGAPDETWLGHRPTMPDSLPVIGPSPSSDRVIFAFGHQHIGLTLGGLTGKVVADLA
FT                   QQRSPTCNLGDFAPQRFT"
     MNTAQPDFDL IVAGAGMVGM SAALYAQMDG LKVALCDPNP PGSGTTYGSA CTIATYACIP        60
     VNSPAIFAAL PYLLTSKDSP LSFNLLHGLK NPCWMLSFLA NCRAARVRRI TEALGRFLAD       120
     ADAGLDPLIM AAGAEDLIVS NDCLYVWSTR AGYEGARASN ALRRAQGVRF EELGPDEVRA       180
     MEPNLKQPIH RGLHFKGARH VTSPQALVGR MQHRFETLGG TYLPARVERC DPDEGGVTVR       240
     LNDGGTLRAG HFALTAGARS RQIAGTGAEG LPLGTERGYH ILYRDHASLV SRPVGWAEAG       300
     FYATPMAQGL RIAGTVEINA IDAPFNTKRT DYLQRKSHEM FGQLGAPDET WLGHRPTMPD       360
     SLPVIGPSPS SDRVIFAFGH QHIGLTLGGL TGKVVADLAQ QRSPTCNLGD FAPQRFT          417
//

If you have problems or comments...

PBIL Back to PBIL home page