(data stored in ACNUC7421 zone)

EMBL: CP000031.PE535

CP000031.PE535       Location/Qualifiers
FT   CDS             complement(539068..541503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0544"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93860"
FT                   /db_xref="GOA:Q5LW00"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW00"
FT                   /protein_id="AAV93860.1"
FT                   /translation="MKQVRVAVIGGGVVGVSVLYHLARLGWTDCCLLERTQLTAGSTWH
FT                   AAGLLPLYYPNQTMSLINKHSMQLYARLQAETGQPSGFHQCGQLRLATDHDRLDEYRAY
FT                   LSFARYLGIDCALITREEAQKLWPLADLGDVIAALYHPGDGHIAPADLTQAMATGARGM
FT                   GAKIHLNTEATAISRTASGEWLISTPNGDFLAEHVVTATGNYARQTGAMVGLNVPSIPV
FT                   MHQYVVTETIKEFADHNRAGRPEMPVLRDDKSRFYLRQENDGLILGPYEPNPKSWAING
FT                   VPPGFGAELMTPDYDSLEPFIEGTLRRVSSFAAAGIRTVVNGPIAHTPDAFPLVGPAPG
FT                   LQNYWLAEGMVAGICYGGGVGRYLAEWITEGAPTIDMWPVDPRRFNGHAGKNHTRLKNE
FT                   ETYGHIFDIHYPNLEMPAARPGKTSPCYDRLTRAGAVWGVAGGWERARWFDAEGNRTPE
FT                   TLTFRRSNAFEAIGAECRAIRNAVGLIDFTSFAKWEVSGAGAMAFLDRALANAMPKRDG
FT                   RVTLAHALDENGRFCAEFTVARLAEDRFYICGPAFSEVHDDHVLRSRLRPADAATLTNV
FT                   SMGWGCFTVAGPKSRELLSRIVDAPLENDSFKWFDLHEGEVGWATDVRLMRVNYCGELG
FT                   WELHHPIAFQHHILDQLEQAGADLGLRHVGMRALDSLRIEKSYRAVAQELTTQNTLHEL
FT                   GLGRFIATGKTGFIGAQAVAERVGKESVKLVTLEVDCEAGGVEPAMNQAVRCGDKVIAL
FT                   TTSGAYGHFLGKHLAMAILPLDHAAEGTRLSVEILDERYDAVVIADSPHDPGNLRPRA"
     MKQVRVAVIG GGVVGVSVLY HLARLGWTDC CLLERTQLTA GSTWHAAGLL PLYYPNQTMS        60
     LINKHSMQLY ARLQAETGQP SGFHQCGQLR LATDHDRLDE YRAYLSFARY LGIDCALITR       120
     EEAQKLWPLA DLGDVIAALY HPGDGHIAPA DLTQAMATGA RGMGAKIHLN TEATAISRTA       180
     SGEWLISTPN GDFLAEHVVT ATGNYARQTG AMVGLNVPSI PVMHQYVVTE TIKEFADHNR       240
     AGRPEMPVLR DDKSRFYLRQ ENDGLILGPY EPNPKSWAIN GVPPGFGAEL MTPDYDSLEP       300
     FIEGTLRRVS SFAAAGIRTV VNGPIAHTPD AFPLVGPAPG LQNYWLAEGM VAGICYGGGV       360
     GRYLAEWITE GAPTIDMWPV DPRRFNGHAG KNHTRLKNEE TYGHIFDIHY PNLEMPAARP       420
     GKTSPCYDRL TRAGAVWGVA GGWERARWFD AEGNRTPETL TFRRSNAFEA IGAECRAIRN       480
     AVGLIDFTSF AKWEVSGAGA MAFLDRALAN AMPKRDGRVT LAHALDENGR FCAEFTVARL       540
     AEDRFYICGP AFSEVHDDHV LRSRLRPADA ATLTNVSMGW GCFTVAGPKS RELLSRIVDA       600
     PLENDSFKWF DLHEGEVGWA TDVRLMRVNY CGELGWELHH PIAFQHHILD QLEQAGADLG       660
     LRHVGMRALD SLRIEKSYRA VAQELTTQNT LHELGLGRFI ATGKTGFIGA QAVAERVGKE       720
     SVKLVTLEVD CEAGGVEPAM NQAVRCGDKV IALTTSGAYG HFLGKHLAMA ILPLDHAAEG       780
     TRLSVEILDE RYDAVVIADS PHDPGNLRPR A                                      811
//

If you have problems or comments...

PBIL Back to PBIL home page