(data stored in ACNUC7421 zone)

EMBL: CP000031.PE537

CP000031.PE537       Location/Qualifiers
FT   CDS             544149..544619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93862"
FT                   /db_xref="GOA:Q5LVZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ8"
FT                   /protein_id="AAV93862.1"
FT                   /translation="MFSHLRFFAHAGAVSRACRRGCNKELLRMKYTLSLHSRSSPFRIV
FT                   LEINGDPDSDSFHWTEIEPDHEKPFFMAASRSLGYFDNSAKHGEIKRAIFKGSGVATDK
FT                   RPPVLELQICRLPEFKIRDFEHCWQGNILRWADSPNYQKQSLQRFTWRAEAV"
     MFSHLRFFAH AGAVSRACRR GCNKELLRMK YTLSLHSRSS PFRIVLEING DPDSDSFHWT        60
     EIEPDHEKPF FMAASRSLGY FDNSAKHGEI KRAIFKGSGV ATDKRPPVLE LQICRLPEFK       120
     IRDFEHCWQG NILRWADSPN YQKQSLQRFT WRAEAV                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page