(data stored in ACNUC7421 zone)

EMBL: CP000031.PE538

CP000031.PE538       Location/Qualifiers
FT   CDS             complement(544720..545253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:H83501"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93863"
FT                   /db_xref="GOA:Q5LVZ7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ7"
FT                   /protein_id="AAV93863.1"
FT                   /translation="MPNYRRARIAGASYFFTLALADRSSTLLTERINDLRHAYALTIRE
FT                   APIVCEAFVVLPDHLHAVWTLPPGDSAFSERWRKIKHRFSRAVGRTAHPTHRSESKRAK
FT                   RECGIWQRRFWEHLIRDEDDFRRHVEYCWGNPVKHGLVDRAVDWPFSTIHRDIRLGRVD
FT                   AQWAGRPTEGAFGE"
     MPNYRRARIA GASYFFTLAL ADRSSTLLTE RINDLRHAYA LTIREAPIVC EAFVVLPDHL        60
     HAVWTLPPGD SAFSERWRKI KHRFSRAVGR TAHPTHRSES KRAKRECGIW QRRFWEHLIR       120
     DEDDFRRHVE YCWGNPVKHG LVDRAVDWPF STIHRDIRLG RVDAQWAGRP TEGAFGE          177
//

If you have problems or comments...

PBIL Back to PBIL home page