(data stored in ACNUC9435 zone)

EMBL: CP000031.PE539

CP000031.PE539       Location/Qualifiers
FT   CDS             545461..545724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93864"
FT                   /db_xref="GOA:Q5LVZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ6"
FT                   /protein_id="AAV93864.1"
FT                   /translation="MRIAVFAISLAYVLLYGWAWVGTVNASMDAAGRGMALGFLTVGIG
FT                   ATAIFVIPALVLAIANRAPKWALGLSLAPAALLFLVVMTGVI"
     MRIAVFAISL AYVLLYGWAW VGTVNASMDA AGRGMALGFL TVGIGATAIF VIPALVLAIA        60
     NRAPKWALGL SLAPAALLFL VVMTGVI                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page