(data stored in ACNUC7421 zone)

EMBL: CP000031.PE541

CP000031.PE541       Location/Qualifiers
FT   CDS             complement(546205..546969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E95936"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93866"
FT                   /db_xref="GOA:Q5LVZ4"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ4"
FT                   /protein_id="AAV93866.1"
FT                   /translation="MTPDWTPLDAELARWAAEGLTLPLWWRDDDAVSTTPQLDRLTALA
FT                   EDLDLPVHLAVIPAGADTALADHVTAHPHLVPVVHGWAHQNHVPATEKKAEFRAHRPLS
FT                   EILTEAGQGKARLQALFGDALRPMFVPPWNRIAPEVTAGLPPLGYRALSTATPRRSPMA
FT                   APGLAQVNTHLDPIDWRGSRGLVAPQTLIAQTATLLADRREGRADATEPFGILTHHLVH
FT                   DDEIWQFSGALLARLLAGPCQPWTMPAEETDR"
     MTPDWTPLDA ELARWAAEGL TLPLWWRDDD AVSTTPQLDR LTALAEDLDL PVHLAVIPAG        60
     ADTALADHVT AHPHLVPVVH GWAHQNHVPA TEKKAEFRAH RPLSEILTEA GQGKARLQAL       120
     FGDALRPMFV PPWNRIAPEV TAGLPPLGYR ALSTATPRRS PMAAPGLAQV NTHLDPIDWR       180
     GSRGLVAPQT LIAQTATLLA DRREGRADAT EPFGILTHHL VHDDEIWQFS GALLARLLAG       240
     PCQPWTMPAE ETDR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page