(data stored in ACNUC9435 zone)

EMBL: CP000031.PE543

CP000031.PE543       Location/Qualifiers
FT   CDS             complement(548102..548686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0552"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93868"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ2"
FT                   /protein_id="AAV93868.1"
FT                   /translation="MRRLALLRHGHTDWNRAGRIQGRSDIPLDDAARHDLGALALPAPW
FT                   DRATLWSSPLSRAVETAKLVAGHTPRNAPALTEMNWGDWEGQRGRDLLDTPGSGYRHIE
FT                   DWGWDFRPPAGESPAEVWTRIDPWLAGLTGDSVAVCHIGIMRVILARAHGWNFDGIPPF
FT                   KVKRNRLFVVSLDPLAPSGEPVRLIPREARP"
     MRRLALLRHG HTDWNRAGRI QGRSDIPLDD AARHDLGALA LPAPWDRATL WSSPLSRAVE        60
     TAKLVAGHTP RNAPALTEMN WGDWEGQRGR DLLDTPGSGY RHIEDWGWDF RPPAGESPAE       120
     VWTRIDPWLA GLTGDSVAVC HIGIMRVILA RAHGWNFDGI PPFKVKRNRL FVVSLDPLAP       180
     SGEPVRLIPR EARP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page