(data stored in ACNUC7421 zone)

EMBL: CP000031.PE545

CP000031.PE545       Location/Qualifiers
FT   CDS             complement(549765..551009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0554"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93870"
FT                   /db_xref="GOA:Q5LVZ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ0"
FT                   /protein_id="AAV93870.1"
FT                   /translation="MTSDSPKLAVVVKGWPRLSETFIAQELVALEEAGHDFDIWSLRHP
FT                   TDVKRHPLHERLRARVRYLPEYLWQEPERVWRARAVAQALPGYAEAYRAWRADLARDRT
FT                   KNRIRRFGQACVMAAELPASTRGLYAHFLHTPASVARYAAIMRGLPWSFSAHAKDIWTS
FT                   PDWEKAEKLSAASHGAAFGATCTAVGATHLRGLTDDPGRVDLVYHGLDLARFPDPPARS
FT                   PRAASAPLAMLSVGRLVEKKGFDRLIAGFGLLPPGLRWHWTHIGGGGDRAALTAQAEAL
FT                   GIAQQITWRGACDQPEVIAAMRAADLFVLPSRVAADGDRDGLPNVLMEAASQLLPILST
FT                   PVSAIPEFITDGAHGTLSDDAPEALARAIATLAADPERAAGMAAAARVRLLSEFTMAPG
FT                   IAHLSNRLTALCAGG"
     MTSDSPKLAV VVKGWPRLSE TFIAQELVAL EEAGHDFDIW SLRHPTDVKR HPLHERLRAR        60
     VRYLPEYLWQ EPERVWRARA VAQALPGYAE AYRAWRADLA RDRTKNRIRR FGQACVMAAE       120
     LPASTRGLYA HFLHTPASVA RYAAIMRGLP WSFSAHAKDI WTSPDWEKAE KLSAASHGAA       180
     FGATCTAVGA THLRGLTDDP GRVDLVYHGL DLARFPDPPA RSPRAASAPL AMLSVGRLVE       240
     KKGFDRLIAG FGLLPPGLRW HWTHIGGGGD RAALTAQAEA LGIAQQITWR GACDQPEVIA       300
     AMRAADLFVL PSRVAADGDR DGLPNVLMEA ASQLLPILST PVSAIPEFIT DGAHGTLSDD       360
     APEALARAIA TLAADPERAA GMAAAARVRL LSEFTMAPGI AHLSNRLTAL CAGG             414
//

If you have problems or comments...

PBIL Back to PBIL home page