(data stored in ACNUC7421 zone)

EMBL: CP000031.PE549

CP000031.PE549       Location/Qualifiers
FT   CDS             complement(556181..557332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0558"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42063"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93874"
FT                   /db_xref="GOA:Q5LVY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY6"
FT                   /protein_id="AAV93874.1"
FT                   /translation="MTQLPDGRYVDDAPYDPQQSIQQLERRDLDAPNWLLVWRKFRTHK
FT                   LGLISGIFLLLSYLLLPFMGFIAPYSPNYRNADHLYAPPQAVRWVHEGDFLGPFIYPIT
FT                   AEADLETFQWTFVPDTENPQRIRFFCEGDSYKLAGLIESDTHLFCAPEGATLFLWGSDR
FT                   LGRDVFSRILYGAQLSLTVGLIGISVSFVLGIFFGSLAGYLGGKTDWVINRVIEILRSL
FT                   PELPLWLALSAAVPSNWSPVAVFFIISVILGILDWPGLARSVRAKFLSLREEEYVRAAE
FT                   MMGAGKGRVIRKHLLPNFMSHLIASATLSIPAMILGETALSFLGLGLRAPAVSWGVMLN
FT                   DAQNLASIELYPWTAIPMLPIVVVVLAFNFLGDGLRDSLDPYS"
     MTQLPDGRYV DDAPYDPQQS IQQLERRDLD APNWLLVWRK FRTHKLGLIS GIFLLLSYLL        60
     LPFMGFIAPY SPNYRNADHL YAPPQAVRWV HEGDFLGPFI YPITAEADLE TFQWTFVPDT       120
     ENPQRIRFFC EGDSYKLAGL IESDTHLFCA PEGATLFLWG SDRLGRDVFS RILYGAQLSL       180
     TVGLIGISVS FVLGIFFGSL AGYLGGKTDW VINRVIEILR SLPELPLWLA LSAAVPSNWS       240
     PVAVFFIISV ILGILDWPGL ARSVRAKFLS LREEEYVRAA EMMGAGKGRV IRKHLLPNFM       300
     SHLIASATLS IPAMILGETA LSFLGLGLRA PAVSWGVMLN DAQNLASIEL YPWTAIPMLP       360
     IVVVVLAFNF LGDGLRDSLD PYS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page