(data stored in ACNUC7421 zone)

EMBL: CP000031.PE55

CP000031.PE55        Location/Qualifiers
FT   CDS             complement(54337..55893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0055"
FT                   /product="OmpA domain protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93386"
FT                   /db_xref="GOA:Q5LWK2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK2"
FT                   /protein_id="AAV93386.1"
FT                   /translation="MNWLRAAALAALSVFPAVPAAAQDITLTSHDGKVEISGNLLGFDG
FT                   EFYRVETRFGELTVDGSGVTCDGPACPNLTDFVAELALSGSSTMAEVLLPALIEGFALR
FT                   NRMQTRRETDSEARFSYLLFQAGSDRPQARFTFRVSTTDEGFADLLADEADLVMALREI
FT                   RPDERRRALELGLGDMTDSNRSRVLALDAMVPVVAPVNPVRQVSVPQLAQVFAGEIDNW
FT                   AQLGGPDAPIALHLPAAGSGLAQAVEDRLLLPAGKSLPETVARHDRSSLLARAVAIDPF
FT                   AIGIASYSETGTARALTLTGDCGFSLAATRRNIKTEDYPLNSPMFLYMPARRLPKLARE
FT                   FMAYMRSPAAQIVIRRAGFVDQAPELIPVAVQGNRLANAIAAAGTEVPLTELQRLVSTL
FT                   SGMQRLSLSFRFETGSSRPDAQSRTNISQLAQELESGAYDARQLLFVGFSDGDGAAEGN
FT                   TRIALKRAEAVRDAVLQTAETLDPARVEVSVDAFGEALPMACDDSDWGRQVNRRVEVWV
FT                   K"
     MNWLRAAALA ALSVFPAVPA AAQDITLTSH DGKVEISGNL LGFDGEFYRV ETRFGELTVD        60
     GSGVTCDGPA CPNLTDFVAE LALSGSSTMA EVLLPALIEG FALRNRMQTR RETDSEARFS       120
     YLLFQAGSDR PQARFTFRVS TTDEGFADLL ADEADLVMAL REIRPDERRR ALELGLGDMT       180
     DSNRSRVLAL DAMVPVVAPV NPVRQVSVPQ LAQVFAGEID NWAQLGGPDA PIALHLPAAG       240
     SGLAQAVEDR LLLPAGKSLP ETVARHDRSS LLARAVAIDP FAIGIASYSE TGTARALTLT       300
     GDCGFSLAAT RRNIKTEDYP LNSPMFLYMP ARRLPKLARE FMAYMRSPAA QIVIRRAGFV       360
     DQAPELIPVA VQGNRLANAI AAAGTEVPLT ELQRLVSTLS GMQRLSLSFR FETGSSRPDA       420
     QSRTNISQLA QELESGAYDA RQLLFVGFSD GDGAAEGNTR IALKRAEAVR DAVLQTAETL       480
     DPARVEVSVD AFGEALPMAC DDSDWGRQVN RRVEVWVK                               518
//

If you have problems or comments...

PBIL Back to PBIL home page