(data stored in ACNUC9435 zone)

EMBL: CP000031.PE551

CP000031.PE551       Location/Qualifiers
FT   CDS             complement(558370..560286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0560"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to GB:BAB50197.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93876"
FT                   /db_xref="GOA:Q5LVY4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY4"
FT                   /protein_id="AAV93876.1"
FT                   /translation="MLELPRRAFALALTMVLAGVLPLRADTVPTLQESVFWGAEVKSGD
FT                   LPPIDQRIPEEPLIVDLAAKGREFGTPGGVMRTMITRSKDIRQMVVYGYARLVGYDENY
FT                   NLVPDLLKSYEVEEDRRFTLHLRKGHKWSDGAPFTSADFEYWWKDVANNPLLSPAGPPD
FT                   FLLIEGQPPRVSFPDATTVMFEWDKPNPNFLQSLAQARPPFIYRPAHFLKQFHQDYADT
FT                   AQLAAAVEENRVKSWAALHNKLDNMYQFDNAQLPTLQPWINASEGKKIRHNFVRNPYYH
FT                   RIDTRGVQLPYIDIIEMEIVAPGLVAAKSNAGEVDLQGRGLDFRDASILKKGEADGGYK
FT                   TYLWQTGVASQIAIYPNLNHNDDVWRALLRDARLRRALSLAIDRDAINRALYFKLAKPG
FT                   AMAVLPASPFFKQEHRDAWAAYDPARASALLDEVGLDKRDGAGIRLLPDGRPMELVIET
FT                   AGERQEVENALQIITDTWREIGVKLVMRPLDRDILRNRVFAGTTMASVWFGWDNGLPQA
FT                   YTSPAYLAPTDQVFLAWPKWGQHYQTAGQVGEAPDLPEAQRLMELLHDWERANNDQDRA
FT                   AAWSEMLAIHADQIYGIGILAEAPQPIVVSARMRNVPKKGMWAWDPGAHFGVHRMDEFF
FT                   IQD"
     MLELPRRAFA LALTMVLAGV LPLRADTVPT LQESVFWGAE VKSGDLPPID QRIPEEPLIV        60
     DLAAKGREFG TPGGVMRTMI TRSKDIRQMV VYGYARLVGY DENYNLVPDL LKSYEVEEDR       120
     RFTLHLRKGH KWSDGAPFTS ADFEYWWKDV ANNPLLSPAG PPDFLLIEGQ PPRVSFPDAT       180
     TVMFEWDKPN PNFLQSLAQA RPPFIYRPAH FLKQFHQDYA DTAQLAAAVE ENRVKSWAAL       240
     HNKLDNMYQF DNAQLPTLQP WINASEGKKI RHNFVRNPYY HRIDTRGVQL PYIDIIEMEI       300
     VAPGLVAAKS NAGEVDLQGR GLDFRDASIL KKGEADGGYK TYLWQTGVAS QIAIYPNLNH       360
     NDDVWRALLR DARLRRALSL AIDRDAINRA LYFKLAKPGA MAVLPASPFF KQEHRDAWAA       420
     YDPARASALL DEVGLDKRDG AGIRLLPDGR PMELVIETAG ERQEVENALQ IITDTWREIG       480
     VKLVMRPLDR DILRNRVFAG TTMASVWFGW DNGLPQAYTS PAYLAPTDQV FLAWPKWGQH       540
     YQTAGQVGEA PDLPEAQRLM ELLHDWERAN NDQDRAAAWS EMLAIHADQI YGIGILAEAP       600
     QPIVVSARMR NVPKKGMWAW DPGAHFGVHR MDEFFIQD                               638
//

If you have problems or comments...

PBIL Back to PBIL home page