(data stored in ACNUC9435 zone)

EMBL: CP000031.PE555

CP000031.PE555       Location/Qualifiers
FT   CDS             563718..566126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0564"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93879"
FT                   /db_xref="GOA:Q5LVY1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY1"
FT                   /protein_id="AAV93879.1"
FT                   /translation="MKSHYRVVVIGGGVVGASVLYHLAKFGWTDVVMLERRRLASGSSW
FT                   HAAGGIHALNADPNMAALQAYTIDLLSEIEKESGQNIGLHMTGGLTLAGTPERWEWLQA
FT                   NYRIFQSIGIDDCELLTPQEAQRRCPIMSTDGVLGAMWADREGYIDTTGTVQAYATAAR
FT                   KRGAEYYEDTKVEQLIQTADGWQVVTDKGTITCEHVVNAAGLWAKQVGRMAGVELPVSP
FT                   LKHHYLITDTVPEVAAAEFEMPMTVDLEGFTYMRQDQKGILVGIYEINHEHWAMDGAPW
FT                   NYGEELFQEQLDRIENELMLGFARYPSIQDVGIKTWVNGAFTFSPDGNPLVGPVPGKRG
FT                   YWSACAVMAGFLQGGGVGKTLAEWMIHGEPEADAWSMDVARYGDYAQNKRYIRETTGQF
FT                   YSRRFVMSYPNEQLPAGRPLKMAPAHDAMTAAGCRWGVSWDLEVPLYFAPSEDFVENLT
FT                   LKRSNAHPIVAEECRVIREGVGLLDITGFSRFEVSGPNAEAWLDKLFATKLPAPGRARL
FT                   AVMLSETGRLKGDLTLLNWGDGTWWIMGSYYLRAWHMRWFNDHLDDGVSVRDLGEEICG
FT                   FGLVGPKSRTVIEKLAEQDISELKFMGCGSFDIGLVRARVARMSVTGEMGYEINCRYGD
FT                   HIALRRMLLEAGAGEDICEVGFNALLSTRIEKSFGIWSAEFTQDRTPGMTAMDRWIAWD
FT                   KGDFIGRDAAIAERDGNGPARVQVTLEVDAADADASGYEPVWADGVQIGFVTSGAYGHY
FT                   TGKSLAMALVDRDRAHPGTSVSVHVVGVERPATIIAPSPYDPDGKAMRG"
     MKSHYRVVVI GGGVVGASVL YHLAKFGWTD VVMLERRRLA SGSSWHAAGG IHALNADPNM        60
     AALQAYTIDL LSEIEKESGQ NIGLHMTGGL TLAGTPERWE WLQANYRIFQ SIGIDDCELL       120
     TPQEAQRRCP IMSTDGVLGA MWADREGYID TTGTVQAYAT AARKRGAEYY EDTKVEQLIQ       180
     TADGWQVVTD KGTITCEHVV NAAGLWAKQV GRMAGVELPV SPLKHHYLIT DTVPEVAAAE       240
     FEMPMTVDLE GFTYMRQDQK GILVGIYEIN HEHWAMDGAP WNYGEELFQE QLDRIENELM       300
     LGFARYPSIQ DVGIKTWVNG AFTFSPDGNP LVGPVPGKRG YWSACAVMAG FLQGGGVGKT       360
     LAEWMIHGEP EADAWSMDVA RYGDYAQNKR YIRETTGQFY SRRFVMSYPN EQLPAGRPLK       420
     MAPAHDAMTA AGCRWGVSWD LEVPLYFAPS EDFVENLTLK RSNAHPIVAE ECRVIREGVG       480
     LLDITGFSRF EVSGPNAEAW LDKLFATKLP APGRARLAVM LSETGRLKGD LTLLNWGDGT       540
     WWIMGSYYLR AWHMRWFNDH LDDGVSVRDL GEEICGFGLV GPKSRTVIEK LAEQDISELK       600
     FMGCGSFDIG LVRARVARMS VTGEMGYEIN CRYGDHIALR RMLLEAGAGE DICEVGFNAL       660
     LSTRIEKSFG IWSAEFTQDR TPGMTAMDRW IAWDKGDFIG RDAAIAERDG NGPARVQVTL       720
     EVDAADADAS GYEPVWADGV QIGFVTSGAY GHYTGKSLAM ALVDRDRAHP GTSVSVHVVG       780
     VERPATIIAP SPYDPDGKAM RG                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page