(data stored in ACNUC7421 zone)

EMBL: CP000031.PE556

CP000031.PE556       Location/Qualifiers
FT   CDS             566123..567646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0565"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93880"
FT                   /db_xref="GOA:Q5LVY0"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY0"
FT                   /protein_id="AAV93880.1"
FT                   /translation="MSAGRRGRRARTEAPASARKVDYRNLRNPFPPMAAFSEDRIEALH
FT                   EASLSVLEELGIKVLHPGARDLYRQGGARIDGEMVHIGREMVEAALASAPKSIRMRGAV
FT                   PDRDVVLELGRMAFQPGAGCPHATDLARGRRPGTIADFRELVQITQSFDVLHMVPPLVE
FT                   AQDVPMHLRHMAMTEVELTQSDKVPFLYSRGTPQVMDGFEMIRDFRGLSDAEFRAQSWC
FT                   YTIINTNSPRTIDMPMAQGLIDFARHGQMAIITPFTLMGAMAPVTVAGAMTLSHAEALA
FT                   AITLSQLAQPGAPVCYGTFTSNVDMKSGAPAFGTPEHFTASLVAGQLARRIGLPWRCAG
FT                   GSAANINDAQAANETQFGLWGCLLAGATVTIHAAGWLEGGLTVSYEKIITDLEVLQMVA
FT                   ELCAGTPATDADIALDALREVPPMGHFFGAAHTMARYQTQFYEPLVGDWSNFGQWSERG
FT                   AVDANHRATGIWRGIVDNFEPPPMDPDRVAALQDFIARRTAEGGAPPES"
     MSAGRRGRRA RTEAPASARK VDYRNLRNPF PPMAAFSEDR IEALHEASLS VLEELGIKVL        60
     HPGARDLYRQ GGARIDGEMV HIGREMVEAA LASAPKSIRM RGAVPDRDVV LELGRMAFQP       120
     GAGCPHATDL ARGRRPGTIA DFRELVQITQ SFDVLHMVPP LVEAQDVPMH LRHMAMTEVE       180
     LTQSDKVPFL YSRGTPQVMD GFEMIRDFRG LSDAEFRAQS WCYTIINTNS PRTIDMPMAQ       240
     GLIDFARHGQ MAIITPFTLM GAMAPVTVAG AMTLSHAEAL AAITLSQLAQ PGAPVCYGTF       300
     TSNVDMKSGA PAFGTPEHFT ASLVAGQLAR RIGLPWRCAG GSAANINDAQ AANETQFGLW       360
     GCLLAGATVT IHAAGWLEGG LTVSYEKIIT DLEVLQMVAE LCAGTPATDA DIALDALREV       420
     PPMGHFFGAA HTMARYQTQF YEPLVGDWSN FGQWSERGAV DANHRATGIW RGIVDNFEPP       480
     PMDPDRVAAL QDFIARRTAE GGAPPES                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page