(data stored in ACNUC7421 zone)

EMBL: CP000031.PE562

CP000031.PE562       Location/Qualifiers
FT   CDS             576429..581300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0571"
FT                   /product="PKD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93886"
FT                   /db_xref="GOA:Q5LVX4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX4"
FT                   /protein_id="AAV93886.1"
FT                   /translation="MEERNMALARNWTAATLAVALLAIGSGTGAQTVADEGLLVVYGPQ
FT                   APSREGDTDRREQVFFSVPASLAERVYVRVFDPETGGEGDFTYGGSADSETTFRLFGGD
FT                   GAYSDADRPEPVADGAREPRLIPYDPVTQPGKMIREQVWGHDLATDGRWVSLAAVRARQ
FT                   GEIVGDRAYFRIDVQGSRGNDGNGYSLGVSLARDRDRAPEGLEMFSYQPTVRWSAGKPA
FT                   TRVDFTRTAPGPLTVQSFDGANGELALITDYRDLGLRISGQDFWTSDEVATDETNLAIS
FT                   LLGGFETPNDVTLAVFDAEGNPVPLSMPPYRAVVPPRPVARGTGQPLADCRSVAFDASG
FT                   STGRTPLSYLWEFDDGARSTDPVVAHRYSEPGRYTARLSLLEPGSRPGRGDRIEVPVHV
FT                   RNAPAAVAGSDIVVAPGQVVDFDGSASQPSDSPITGYRWTFGDGGAAQGPRAQHVYDQP
FT                   GQYRAVLRVQDDAVHPCNFGTAVRRVVVNFAPVAEAGTDQSAIVGQAVTLSGAASYDVD
FT                   GAILDYRWSMGDGTVLSGETVTHRYEQSGSYQVLLTVTDDSGVVNKIATDGARIEVNAP
FT                   PEPRFTIPDRPVSVSEVAVLDASASTDADGQILSYIWDFGDGAMGEGPVASYAWTRAGE
FT                   FSVTLTVEDDSATASALQSITRIVRVDAAPVADAGPDQYVTATEVRFDGGGSVDPDGRV
FT                   TDWQWDFGDGATASGQSVTHAYLRPGRYEVALIVRDDSGAPLNTHRDTMWLTINTAPIA
FT                   DAGPPQVVAPGEEFLLSGGASVDPDGAISDYLWTFPDGQVKQGQRVSHVLDEPGLHRIR
FT                   LTVADNFAGGAAEDEAEVLITVNAAPVAVAGRDLLIAPGDTVVFDAGQSFDPDGRLTSY
FT                   RWEFEDLGAPLEAQRVERAFDAPGVWSAQLVVADDSGVLNATAADDVTIRVNHPPVAEA
FT                   GAPVITDQLHVTFDGSGSKDGDGDPLIHRWDFGDGSPPVYGETVTHVFPRAGIFPVTLR
FT                   VDDGTGLSNARAIDATAVTIQARPMADAGGNRDVCSGEPILFDASASADPDGGLLAYEW
FT                   DFGDGSGSDLINPTKTYELPGVYPVTLKVRNGTGTEHGTAVDRIAALVREGPIADAGPD
FT                   MTVCSNAQVRFDGSGSSDADGAVNAFTWTFGDGGSGSGATPQHIFRTPGTYSVTLTITG
FT                   DARGACSPLDTDVSQVTVIAAPELKVLGQGRAAAGIPASFSAGLDQLGGASPEGFSWSI
FT                   SDGTTYEGRDIEHVFAEPGDYLVTLRSRLSGGTEACSELEVQRRIIVNAAPEPVIDAPL
FT                   RVSVGQSVRFDAGGSSDSDGAIARFAWAFGDGAGAEGVQAVHRYETPGSYEVSLTVTDD
FT                   AGVANSQITRRQQIEVAPSPVAGLTARGAVCPGVSLPWAVSPGGETAVGWAFGDGTVAE
FT                   GAETRHGFDRPGLMPVRVELDDGRDLPGSRRAEEIYVRVNAQPTALAGPDRVVCPGEVV
FT                   VFDAGGSGDVDGDLTSWRWTFSDGVTLEGARVERVFDAAADLTVQLSVQDDSGAEGCDI
FT                   GTDSARILVNGTPQVDAGPDLTVPVGGAHDVVRFDAGAASDPDGHGLRLSWSFGDGTEA
FT                   TGAVVRHRFANPGSYTVTLRAQDSTGLVCGIGRDTATVTAVARD"
     MEERNMALAR NWTAATLAVA LLAIGSGTGA QTVADEGLLV VYGPQAPSRE GDTDRREQVF        60
     FSVPASLAER VYVRVFDPET GGEGDFTYGG SADSETTFRL FGGDGAYSDA DRPEPVADGA       120
     REPRLIPYDP VTQPGKMIRE QVWGHDLATD GRWVSLAAVR ARQGEIVGDR AYFRIDVQGS       180
     RGNDGNGYSL GVSLARDRDR APEGLEMFSY QPTVRWSAGK PATRVDFTRT APGPLTVQSF       240
     DGANGELALI TDYRDLGLRI SGQDFWTSDE VATDETNLAI SLLGGFETPN DVTLAVFDAE       300
     GNPVPLSMPP YRAVVPPRPV ARGTGQPLAD CRSVAFDASG STGRTPLSYL WEFDDGARST       360
     DPVVAHRYSE PGRYTARLSL LEPGSRPGRG DRIEVPVHVR NAPAAVAGSD IVVAPGQVVD       420
     FDGSASQPSD SPITGYRWTF GDGGAAQGPR AQHVYDQPGQ YRAVLRVQDD AVHPCNFGTA       480
     VRRVVVNFAP VAEAGTDQSA IVGQAVTLSG AASYDVDGAI LDYRWSMGDG TVLSGETVTH       540
     RYEQSGSYQV LLTVTDDSGV VNKIATDGAR IEVNAPPEPR FTIPDRPVSV SEVAVLDASA       600
     STDADGQILS YIWDFGDGAM GEGPVASYAW TRAGEFSVTL TVEDDSATAS ALQSITRIVR       660
     VDAAPVADAG PDQYVTATEV RFDGGGSVDP DGRVTDWQWD FGDGATASGQ SVTHAYLRPG       720
     RYEVALIVRD DSGAPLNTHR DTMWLTINTA PIADAGPPQV VAPGEEFLLS GGASVDPDGA       780
     ISDYLWTFPD GQVKQGQRVS HVLDEPGLHR IRLTVADNFA GGAAEDEAEV LITVNAAPVA       840
     VAGRDLLIAP GDTVVFDAGQ SFDPDGRLTS YRWEFEDLGA PLEAQRVERA FDAPGVWSAQ       900
     LVVADDSGVL NATAADDVTI RVNHPPVAEA GAPVITDQLH VTFDGSGSKD GDGDPLIHRW       960
     DFGDGSPPVY GETVTHVFPR AGIFPVTLRV DDGTGLSNAR AIDATAVTIQ ARPMADAGGN      1020
     RDVCSGEPIL FDASASADPD GGLLAYEWDF GDGSGSDLIN PTKTYELPGV YPVTLKVRNG      1080
     TGTEHGTAVD RIAALVREGP IADAGPDMTV CSNAQVRFDG SGSSDADGAV NAFTWTFGDG      1140
     GSGSGATPQH IFRTPGTYSV TLTITGDARG ACSPLDTDVS QVTVIAAPEL KVLGQGRAAA      1200
     GIPASFSAGL DQLGGASPEG FSWSISDGTT YEGRDIEHVF AEPGDYLVTL RSRLSGGTEA      1260
     CSELEVQRRI IVNAAPEPVI DAPLRVSVGQ SVRFDAGGSS DSDGAIARFA WAFGDGAGAE      1320
     GVQAVHRYET PGSYEVSLTV TDDAGVANSQ ITRRQQIEVA PSPVAGLTAR GAVCPGVSLP      1380
     WAVSPGGETA VGWAFGDGTV AEGAETRHGF DRPGLMPVRV ELDDGRDLPG SRRAEEIYVR      1440
     VNAQPTALAG PDRVVCPGEV VVFDAGGSGD VDGDLTSWRW TFSDGVTLEG ARVERVFDAA      1500
     ADLTVQLSVQ DDSGAEGCDI GTDSARILVN GTPQVDAGPD LTVPVGGAHD VVRFDAGAAS      1560
     DPDGHGLRLS WSFGDGTEAT GAVVRHRFAN PGSYTVTLRA QDSTGLVCGI GRDTATVTAV      1620
     ARD                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page