(data stored in ACNUC9435 zone)

EMBL: CP000031.PE564

CP000031.PE564       Location/Qualifiers
FT   CDS             complement(583201..583596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ87470.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93888"
FT                   /db_xref="GOA:Q5LVX2"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX2"
FT                   /protein_id="AAV93888.1"
FT                   /translation="MFLPVTIGSLLLVLGLFQIKHMFADFFLQTPRMLSGRCQYWHLGR
FT                   AQHAGVHAVGSVLLFLVVGAPVVFALVIAVVEWVVHFNIDYGKASYSDRKALQPNQAKY
FT                   WHAMGFDQFLHQLTYLAMAWAWVEFAH"
     MFLPVTIGSL LLVLGLFQIK HMFADFFLQT PRMLSGRCQY WHLGRAQHAG VHAVGSVLLF        60
     LVVGAPVVFA LVIAVVEWVV HFNIDYGKAS YSDRKALQPN QAKYWHAMGF DQFLHQLTYL       120
     AMAWAWVEFA H                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page