(data stored in ACNUC7421 zone)

EMBL: CP000031.PE565

CP000031.PE565       Location/Qualifiers
FT   CDS             583706..586804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0574"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93889"
FT                   /db_xref="GOA:Q5LVX1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX1"
FT                   /protein_id="AAV93889.1"
FT                   /translation="MSGRDSLGEGRRLRVWRPSCLRPILGVGAIERTLFRFIWKYSRRD
FT                   QLILLMVTATLFPLLYLTLELPKRIINDAIGAASSTIEVWGFTFDQVTYLGILCAAFLI
FT                   SVLAHGLMKMRINTMKGVMSERMLRRFRYLLITRVLRFPQPYFERVSQGELVSMITAES
FT                   EPMGGLMGDAISQPVLQAGQMITILSFLFLQSLWFGLAAVALIPLQAWLIPRMQRQINL
FT                   LNKKRIQEVRVLAAQIGENAAGAATLRSNAGWPWRMSMISYQLGRLFTIRFDIYQKKFF
FT                   MKFVNNFIGQLTPFLFYSIGGYLVLQGSVSLGALVAALAAYKDLSSPWKELLTYYNQTQ
FT                   DMSLRWEVILDRFAPPGMIDEDKFTGFPDERPRLIGDIVLDKVSVRDADGNLVLDDLDL
FT                   TLPGGKVIGIAASSEEDRRALSELLTREVLPASGQVRIGEIALSDLHQMVVASRIGHAT
FT                   SRPVLFQGTFGDNVTMPVRVRPQGDSGEPGFHAETLRAGNSADPYHSDWLEPGLAGFDD
FT                   ARALRDWWLKLVEGLGSGAALYRRGAEQVFAEADHPDLAARLVALRPVIQEAAERAGLA
FT                   GQAHFFDPDHYNPALPVAENLLFASPRAPFTPEVLAGQTDFLEQIRQIGLDEPLVRLTQ
FT                   DVIDMLRQIFGLDGTDHPLFRKMNLDVRTYETALELVEKTRDAGARALEDDQLASLLAV
FT                   PFRISADQIGPAFSDQIKARILELRKSHSSELMRSLDDVFAPLDPGAFAPGLNVLENAL
FT                   FGKVSEVGGARSDELRKLITDLLDEHGLRPQVIQLIYDLPVTLGGQNVPAIFAEPLAFT
FT                   RATIKRPDILLLDRALASYDMQTQIAVYRNLRALLPETTLIYLNDAFENPDVFDLYVEV
FT                   QQGRIVTEEVPRQQEEEDSVASADLSRKVRTLEQTPLFSGLDRRQLRLLAFGARWYSAK
FT                   AGEVVFLKDDEPTDGAYMMIEGEAGLYLPREGQEDQLIVTVGPGRLVGELGLIRKEPRA
FT                   LSMVAATDITCLRIGEEEFLAVVENDAATAFKLLQVVAGYVSN"
     MSGRDSLGEG RRLRVWRPSC LRPILGVGAI ERTLFRFIWK YSRRDQLILL MVTATLFPLL        60
     YLTLELPKRI INDAIGAASS TIEVWGFTFD QVTYLGILCA AFLISVLAHG LMKMRINTMK       120
     GVMSERMLRR FRYLLITRVL RFPQPYFERV SQGELVSMIT AESEPMGGLM GDAISQPVLQ       180
     AGQMITILSF LFLQSLWFGL AAVALIPLQA WLIPRMQRQI NLLNKKRIQE VRVLAAQIGE       240
     NAAGAATLRS NAGWPWRMSM ISYQLGRLFT IRFDIYQKKF FMKFVNNFIG QLTPFLFYSI       300
     GGYLVLQGSV SLGALVAALA AYKDLSSPWK ELLTYYNQTQ DMSLRWEVIL DRFAPPGMID       360
     EDKFTGFPDE RPRLIGDIVL DKVSVRDADG NLVLDDLDLT LPGGKVIGIA ASSEEDRRAL       420
     SELLTREVLP ASGQVRIGEI ALSDLHQMVV ASRIGHATSR PVLFQGTFGD NVTMPVRVRP       480
     QGDSGEPGFH AETLRAGNSA DPYHSDWLEP GLAGFDDARA LRDWWLKLVE GLGSGAALYR       540
     RGAEQVFAEA DHPDLAARLV ALRPVIQEAA ERAGLAGQAH FFDPDHYNPA LPVAENLLFA       600
     SPRAPFTPEV LAGQTDFLEQ IRQIGLDEPL VRLTQDVIDM LRQIFGLDGT DHPLFRKMNL       660
     DVRTYETALE LVEKTRDAGA RALEDDQLAS LLAVPFRISA DQIGPAFSDQ IKARILELRK       720
     SHSSELMRSL DDVFAPLDPG AFAPGLNVLE NALFGKVSEV GGARSDELRK LITDLLDEHG       780
     LRPQVIQLIY DLPVTLGGQN VPAIFAEPLA FTRATIKRPD ILLLDRALAS YDMQTQIAVY       840
     RNLRALLPET TLIYLNDAFE NPDVFDLYVE VQQGRIVTEE VPRQQEEEDS VASADLSRKV       900
     RTLEQTPLFS GLDRRQLRLL AFGARWYSAK AGEVVFLKDD EPTDGAYMMI EGEAGLYLPR       960
     EGQEDQLIVT VGPGRLVGEL GLIRKEPRAL SMVAATDITC LRIGEEEFLA VVENDAATAF      1020
     KLLQVVAGYV SN                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page