(data stored in ACNUC7421 zone)

EMBL: CP000031.PE568

CP000031.PE568       Location/Qualifiers
FT   CDS             588797..590560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0577"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D83286"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93892"
FT                   /db_xref="GOA:Q5LVW8"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW8"
FT                   /protein_id="AAV93892.1"
FT                   /translation="MTAALRIGGACGFWGEAPHATAQLLAAGVDVLVYDYLAEITMSIM
FT                   ARARLKDPDQGYATDFVTEAMVPNLTAIAKQGVRVLSNAGGVNPEACAEALRERIAAAG
FT                   LSLRVAVVTGDDLLARASEFVKCTEMFTGAAMPPLERIASMNAYLGAAPVVAALRAGAD
FT                   IVLTGRCADSALTLAACVHHFGWDLSDHDRLAAGSLAGHLLECGPQATGGNFTDWEVAG
FT                   DLARIGYPIAEVAADGGFVLTKPEGSSGLVTPATVGEQMLYEIGDPRAYLLPDVVCDFS
FT                   GVTLEQAGPDRVRVSGARGRAPTGRLKVSVTWADGYRGGMVFQMTGRAARAKAQAFAQA
FT                   GLDRAQARLAALGAPGYREVSFEAFGGRPAPDAPEEIAFKAAVRHDDARAVGLFLKELV
FT                   GAALATPPGLHFFTGAGRPRPSPVVALFSCLIPADAVRASVVLDGADLSFDAPAPPLRD
FT                   IEEGLAPCPPEPDMELELEMRPLEALAWARSGDKGDSANIGVLARRPDYMPYIWAALSP
FT                   EAVMRFFDEKSPAQIQRFYLPGCHAMNILLTGALGGGGVASLRNDAQGKAFAQELLSLP
FT                   VPVPVGLITTD"
     MTAALRIGGA CGFWGEAPHA TAQLLAAGVD VLVYDYLAEI TMSIMARARL KDPDQGYATD        60
     FVTEAMVPNL TAIAKQGVRV LSNAGGVNPE ACAEALRERI AAAGLSLRVA VVTGDDLLAR       120
     ASEFVKCTEM FTGAAMPPLE RIASMNAYLG AAPVVAALRA GADIVLTGRC ADSALTLAAC       180
     VHHFGWDLSD HDRLAAGSLA GHLLECGPQA TGGNFTDWEV AGDLARIGYP IAEVAADGGF       240
     VLTKPEGSSG LVTPATVGEQ MLYEIGDPRA YLLPDVVCDF SGVTLEQAGP DRVRVSGARG       300
     RAPTGRLKVS VTWADGYRGG MVFQMTGRAA RAKAQAFAQA GLDRAQARLA ALGAPGYREV       360
     SFEAFGGRPA PDAPEEIAFK AAVRHDDARA VGLFLKELVG AALATPPGLH FFTGAGRPRP       420
     SPVVALFSCL IPADAVRASV VLDGADLSFD APAPPLRDIE EGLAPCPPEP DMELELEMRP       480
     LEALAWARSG DKGDSANIGV LARRPDYMPY IWAALSPEAV MRFFDEKSPA QIQRFYLPGC       540
     HAMNILLTGA LGGGGVASLR NDAQGKAFAQ ELLSLPVPVP VGLITTD                     587
//

If you have problems or comments...

PBIL Back to PBIL home page