(data stored in ACNUC7421 zone)

EMBL: CP000031.PE576

CP000031.PE576       Location/Qualifiers
FT   CDS             599692..601914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0585"
FT                   /product="dehydrogenase/transketolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93900"
FT                   /db_xref="GOA:Q5LVW0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW0"
FT                   /protein_id="AAV93900.1"
FT                   /translation="MTPSIKEGPAMDRAQIVHENFLSRVAARDLPKGAPPRPGLTQAQA
FT                   VSLYRAQVLSRALDRTSRAMQKAGQGFYTIGSSGHEGMAAVAQALRPTDIAFLHYRDAA
FT                   FQIARAEQVPGQQIAWDMLLSFACSKEDPASGGRHKVLGSKALMIPPQTSTIASHLPKA
FT                   VGAAYSLGAARRHPPEHRQLPEDGIAMCSFGDASANHSTAQGAINTAGWTSVQSIPLPL
FT                   LFVCEDNGIGISTKTPRGWIQASMEHRPGIRYFQANGLDIYETYAVAQEAADYVRNRRK
FT                   PAFLHLKTVRLYGHAGADVPTTYLTRAEVEAEEAMDPLLHSVRLLAEDGALASEEALAI
FT                   YEQTCARIDRIAVEAATRPHLASAAEVAASLIPPKRECKPTNGPGAEMRAATFGGDMRA
FT                   MDEPQPMSRLINWALTDLMLEHGEIVCMGEDVGRKGGVYGVTQKLQQRFGPDRMIDTLL
FT                   DEQSILGLAIGMGHNGFLPIPEIQFLAYLHNAEDQIRGEAATLPFFSNGQFTNPMVLRI
FT                   AGLGYQKGFGGHFHNDNSLAVLRDIPGVIIACPSTGEDAAQMLRECVRLAREEQRVVVF
FT                   LEPIALYPMRDLHGVQDGGWMTPYPSPDRRIALGEVGVHGNGTDLAIVTYGNGHYLSQQ
FT                   AVPEIEAAGIRARIIDLRWLAPLPIEALRAATKDCKHVLIVDECRRTGSQSEALMTFFC
FT                   EESRATSTARVVAEDCFIATGPAYAAPLPSRDGIVAAALSLTGVAK"
     MTPSIKEGPA MDRAQIVHEN FLSRVAARDL PKGAPPRPGL TQAQAVSLYR AQVLSRALDR        60
     TSRAMQKAGQ GFYTIGSSGH EGMAAVAQAL RPTDIAFLHY RDAAFQIARA EQVPGQQIAW       120
     DMLLSFACSK EDPASGGRHK VLGSKALMIP PQTSTIASHL PKAVGAAYSL GAARRHPPEH       180
     RQLPEDGIAM CSFGDASANH STAQGAINTA GWTSVQSIPL PLLFVCEDNG IGISTKTPRG       240
     WIQASMEHRP GIRYFQANGL DIYETYAVAQ EAADYVRNRR KPAFLHLKTV RLYGHAGADV       300
     PTTYLTRAEV EAEEAMDPLL HSVRLLAEDG ALASEEALAI YEQTCARIDR IAVEAATRPH       360
     LASAAEVAAS LIPPKRECKP TNGPGAEMRA ATFGGDMRAM DEPQPMSRLI NWALTDLMLE       420
     HGEIVCMGED VGRKGGVYGV TQKLQQRFGP DRMIDTLLDE QSILGLAIGM GHNGFLPIPE       480
     IQFLAYLHNA EDQIRGEAAT LPFFSNGQFT NPMVLRIAGL GYQKGFGGHF HNDNSLAVLR       540
     DIPGVIIACP STGEDAAQML RECVRLAREE QRVVVFLEPI ALYPMRDLHG VQDGGWMTPY       600
     PSPDRRIALG EVGVHGNGTD LAIVTYGNGH YLSQQAVPEI EAAGIRARII DLRWLAPLPI       660
     EALRAATKDC KHVLIVDECR RTGSQSEALM TFFCEESRAT STARVVAEDC FIATGPAYAA       720
     PLPSRDGIVA AALSLTGVAK                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page