(data stored in ACNUC7421 zone)

EMBL: CP000031.PE58

CP000031.PE58        Location/Qualifiers
FT   CDS             59912..60742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0058"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93389"
FT                   /db_xref="GOA:Q5LWL7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL7"
FT                   /protein_id="AAV93389.1"
FT                   /translation="MPSLAFALVMALPVAAETKAEADTVVARVNGEEITLGHMIIARAS
FT                   LPQQYQQLPDDVLFDGILDQLVQQTLLKQQQKGETPKQIVLSLENEERSLLAGETIEEI
FT                   MAVATTETAIQAAYDAQYADGFGGEEYNASHILVPSEDEAKAVKELLDNGADFAATAKE
FT                   KSTGPSGPNGGALGWFGAGAMVPEFEQAVVALNAGQVSDPVQTQFGWHVIILNDKRKSE
FT                   APALDEVRDELAGRIQQDAIEARLAELTKDSEIEKPELTGVEPAVLRQLELVRE"
     MPSLAFALVM ALPVAAETKA EADTVVARVN GEEITLGHMI IARASLPQQY QQLPDDVLFD        60
     GILDQLVQQT LLKQQQKGET PKQIVLSLEN EERSLLAGET IEEIMAVATT ETAIQAAYDA       120
     QYADGFGGEE YNASHILVPS EDEAKAVKEL LDNGADFAAT AKEKSTGPSG PNGGALGWFG       180
     AGAMVPEFEQ AVVALNAGQV SDPVQTQFGW HVIILNDKRK SEAPALDEVR DELAGRIQQD       240
     AIEARLAELT KDSEIEKPEL TGVEPAVLRQ LELVRE                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page