(data stored in ACNUC7421 zone)

EMBL: CP000031.PE580

CP000031.PE580       Location/Qualifiers
FT   CDS             605196..608468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0589"
FT                   /product="oxidoreductase, NAD-binding/iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93904"
FT                   /db_xref="GOA:Q5LVV6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV6"
FT                   /protein_id="AAV93904.1"
FT                   /translation="MVLLSIPRYAKRAVRRRRMGIRFFSDRDRPVHMGPYPLERLARRE
FT                   AVADLSTVPQIPVLSFHRPERPESIVNAMGEFQAMLDAIRDGLVNPARAEISADPLERA
FT                   NHLKAFGYFNDASMMGCGPLPAEALLPAPRRNPDIDRLAEALRTRQTKTLASGIDVIMA
FT                   DLKESMEAPPRPIDSHRHAIVFLYEHHRDPEADEPGAEWIHDAQDHRACLLASENAVVI
FT                   ANYIRLLGYDARAHTAMSSDVDLGRLALAAGLVTLEGGQLAAPWLGRRFGLAAVTTEME
FT                   LAHDRPLAPLAAQSWAATRGPAWWLGKGFAKSALNRDPYARRRYVDGAHPFERLNRVET
FT                   PTTYIDEANVARVPKRADMFARAQFGDMGKALQEGAKGGHYVRKAAPSFAQRRALGAFV
FT                   LLQDGDRADVPRPIDPRRNAANLKAASYFLGIDAVGLSRCPTWAWYSHDATGEAITPPH
FT                   DQAISMIVDQGYETMEGSSGDDWIAVAQSMRAYLRFSLLGGVIAQQIRNLGYKAKAHTV
FT                   MDGEVLQPPLLLLSGLGEVSRIGEVILNPFLGPRLKSGAVTTDMPMSHDKPIDFGLQRF
FT                   CEACNKCARECPSGAITAGPKRMFNGYEIWKSDSQKCATYRITTQGGAMCGRCMKTCPW
FT                   NLEGLFAERPFRWAAMTVPAAAPALARLDDALGHGGLNEVKKWWWDIELQPDGAYRPTT
FT                   GPVNRRGLQRDLDLKYEDQTLAVYPAPLAPHPWPYPFPMDREAGIAAYQAMIGADEYRA
FT                   RLAAGDLSVVHRYTVPDADTAPVIRVEVTRAEKMTGEITKYEFAAPDGAPLPEWTAGAH
FT                   LDVLVAPEFLRQYSMSGDPTDRTTYQIGVLREEEGRGGSKLMHRIFAPGRRVFISKPIN
FT                   HFELDEGATRSFLMGGGIGITPMIAFAHRLHALGADFELHYSVPSRTSAGYLEDLDAMP
FT                   WADRVHLHVSDEGSRADLDAVLAGFQPGWHVYTCGPERFMDGVMQAAERQGFPEEARHL
FT                   EYFSVPEQPAYENHPFTLKLARTGREIAVPADKDAAQVLNENGIHIDVKCSDGICGVCK
FT                   CGLIAGAVEHRDFVLSGKQREGAIILCQSRAAEPGGVVEIDL"
     MVLLSIPRYA KRAVRRRRMG IRFFSDRDRP VHMGPYPLER LARREAVADL STVPQIPVLS        60
     FHRPERPESI VNAMGEFQAM LDAIRDGLVN PARAEISADP LERANHLKAF GYFNDASMMG       120
     CGPLPAEALL PAPRRNPDID RLAEALRTRQ TKTLASGIDV IMADLKESME APPRPIDSHR       180
     HAIVFLYEHH RDPEADEPGA EWIHDAQDHR ACLLASENAV VIANYIRLLG YDARAHTAMS       240
     SDVDLGRLAL AAGLVTLEGG QLAAPWLGRR FGLAAVTTEM ELAHDRPLAP LAAQSWAATR       300
     GPAWWLGKGF AKSALNRDPY ARRRYVDGAH PFERLNRVET PTTYIDEANV ARVPKRADMF       360
     ARAQFGDMGK ALQEGAKGGH YVRKAAPSFA QRRALGAFVL LQDGDRADVP RPIDPRRNAA       420
     NLKAASYFLG IDAVGLSRCP TWAWYSHDAT GEAITPPHDQ AISMIVDQGY ETMEGSSGDD       480
     WIAVAQSMRA YLRFSLLGGV IAQQIRNLGY KAKAHTVMDG EVLQPPLLLL SGLGEVSRIG       540
     EVILNPFLGP RLKSGAVTTD MPMSHDKPID FGLQRFCEAC NKCARECPSG AITAGPKRMF       600
     NGYEIWKSDS QKCATYRITT QGGAMCGRCM KTCPWNLEGL FAERPFRWAA MTVPAAAPAL       660
     ARLDDALGHG GLNEVKKWWW DIELQPDGAY RPTTGPVNRR GLQRDLDLKY EDQTLAVYPA       720
     PLAPHPWPYP FPMDREAGIA AYQAMIGADE YRARLAAGDL SVVHRYTVPD ADTAPVIRVE       780
     VTRAEKMTGE ITKYEFAAPD GAPLPEWTAG AHLDVLVAPE FLRQYSMSGD PTDRTTYQIG       840
     VLREEEGRGG SKLMHRIFAP GRRVFISKPI NHFELDEGAT RSFLMGGGIG ITPMIAFAHR       900
     LHALGADFEL HYSVPSRTSA GYLEDLDAMP WADRVHLHVS DEGSRADLDA VLAGFQPGWH       960
     VYTCGPERFM DGVMQAAERQ GFPEEARHLE YFSVPEQPAY ENHPFTLKLA RTGREIAVPA      1020
     DKDAAQVLNE NGIHIDVKCS DGICGVCKCG LIAGAVEHRD FVLSGKQREG AIILCQSRAA      1080
     EPGGVVEIDL                                                             1090
//

If you have problems or comments...

PBIL Back to PBIL home page