(data stored in ACNUC7421 zone)

EMBL: CP000031.PE595

CP000031.PE595       Location/Qualifiers
FT   CDS             complement(623375..623752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC62948.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93919"
FT                   /db_xref="GOA:Q5LVU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU1"
FT                   /protein_id="AAV93919.1"
FT                   /translation="MTNKTFLTAHGVIYMFFALALFFAPALLWPNYGLQLNDRYAVFLS
FT                   QHNSIFLGGIGVTSFLFRHVAQGSEAARTFLTGLIWTNALGVVITLYACLTGIFSGFGW
FT                   SDPIFFALLAVLSFMQLGKNR"
     MTNKTFLTAH GVIYMFFALA LFFAPALLWP NYGLQLNDRY AVFLSQHNSI FLGGIGVTSF        60
     LFRHVAQGSE AARTFLTGLI WTNALGVVIT LYACLTGIFS GFGWSDPIFF ALLAVLSFMQ       120
     LGKNR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page