(data stored in ACNUC9435 zone)

EMBL: CP000031.PE597

CP000031.PE597       Location/Qualifiers
FT   CDS             624480..626168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0606"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:C95874"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93921"
FT                   /db_xref="GOA:Q5LVT9"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT9"
FT                   /protein_id="AAV93921.1"
FT                   /translation="MAQCIVAAAASGPVLVCDEGLSFWGGVDPETGRVIDAHHPQHGAA
FT                   LAGAVVMMPTSRGSCSGSGVLLALALNGHAPAALVFREGEDVLTLGALVAAWMYDRPVA
FT                   VLRLSAAEYAALAMEPSAEVTPERLTAGALSLTLEPLSGETLDLSDADRAMLSEEAAPP
FT                   VRLAMRIICAMAAAQGAERLTDVSRAHIDGCIYHSEANLRFAEDMAAMGGRVCIPTTMN
FT                   AISVDHANWRAQGVPPAFGGPASRLADAYLRMGARPSFTCAPYLLDDIPQAGEAIAWAE
FT                   SNAVVYANSVLAARSVKHPDYLDLCMALTGRAPLAGVYLDANRKAQVEIRVERPEGADD
FT                   AFWPLLGYLAGRLAPDRIPLLTGLEGSAPSGDDLKALCAAFGTTSAAAMLHVAGVTPEA
FT                   DGALTDGAAHMAIAPGDFARAWDQFNPGPQRVELVAIGSPHASAHECRVLTDLLDGHRI
FT                   ADGTATIVTIGRGERDKLAGDGVLARLQALGVQVIPDLCWCSVTEPVLPPATRTIMTNS
FT                   GKYAHYGPGLSGRAMRFGSLAHCAEAALTGYAPGRPGWINGQDRV"
     MAQCIVAAAA SGPVLVCDEG LSFWGGVDPE TGRVIDAHHP QHGAALAGAV VMMPTSRGSC        60
     SGSGVLLALA LNGHAPAALV FREGEDVLTL GALVAAWMYD RPVAVLRLSA AEYAALAMEP       120
     SAEVTPERLT AGALSLTLEP LSGETLDLSD ADRAMLSEEA APPVRLAMRI ICAMAAAQGA       180
     ERLTDVSRAH IDGCIYHSEA NLRFAEDMAA MGGRVCIPTT MNAISVDHAN WRAQGVPPAF       240
     GGPASRLADA YLRMGARPSF TCAPYLLDDI PQAGEAIAWA ESNAVVYANS VLAARSVKHP       300
     DYLDLCMALT GRAPLAGVYL DANRKAQVEI RVERPEGADD AFWPLLGYLA GRLAPDRIPL       360
     LTGLEGSAPS GDDLKALCAA FGTTSAAAML HVAGVTPEAD GALTDGAAHM AIAPGDFARA       420
     WDQFNPGPQR VELVAIGSPH ASAHECRVLT DLLDGHRIAD GTATIVTIGR GERDKLAGDG       480
     VLARLQALGV QVIPDLCWCS VTEPVLPPAT RTIMTNSGKY AHYGPGLSGR AMRFGSLAHC       540
     AEAALTGYAP GRPGWINGQD RV                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page