(data stored in ACNUC9435 zone)

EMBL: CP000031.PE599

CP000031.PE599       Location/Qualifiers
FT   CDS             627307..629085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0608"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transporter operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93923"
FT                   /db_xref="GOA:Q5LVT7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT7"
FT                   /protein_id="AAV93923.1"
FT                   /translation="MPQSISGIADNREEKMRRYLLSAAAVCAVVAGQAAYADEAAAKKW
FT                   IDEEFQPSVLSKDEQMAEMQWFIKAAEPYAGMEINVLSEGIPTHSYESEVLTKAFEEIT
FT                   GIKVNHQILGEGEVVQAVQTQMQTKRNLYDAYVNDSDLIGTHSRLQLAYNLTDMMAGDF
FT                   KDVTNPGLDLGDFMGTQFTTGPDGDLYQLPDQQFANLYWFRKDWFDREDLKAAFKAKYG
FT                   YELGVPVNWSAYEDIAEFFSEDVKEIDGTAIYGHMDYGKRAPDLGWRMTDAWLSMAGAG
FT                   SKGEPNGIPIDEWGIRMEAGSCNPAGASVTRGGAANGPAAVYAIRKWDEWLRKYAPPGA
FT                   ASYDFYQSLPALAQGNVAQQIFWYTAFTADMVKPQSEGNNTVDGDGNPLWRMAPSPHGP
FT                   YWEDGQKVGYQDVGSWTILNSTPLDRAQAAWLYAQFVVSKTVDVKKSHVGLTFIRDSSV
FT                   NHESFSERAAKLGGLVEFYRSPDRVRWSPTGINVPDYPKLAQIWWQQIGDVNSGAFTPQ
FT                   EAMDRLAFEMDTVMARMQAADEAANVYGGCGPRLNEEKDAEWWFANGGAKPKLDNEKPQ
FT                   GETVNYDELVARWAKN"
     MPQSISGIAD NREEKMRRYL LSAAAVCAVV AGQAAYADEA AAKKWIDEEF QPSVLSKDEQ        60
     MAEMQWFIKA AEPYAGMEIN VLSEGIPTHS YESEVLTKAF EEITGIKVNH QILGEGEVVQ       120
     AVQTQMQTKR NLYDAYVNDS DLIGTHSRLQ LAYNLTDMMA GDFKDVTNPG LDLGDFMGTQ       180
     FTTGPDGDLY QLPDQQFANL YWFRKDWFDR EDLKAAFKAK YGYELGVPVN WSAYEDIAEF       240
     FSEDVKEIDG TAIYGHMDYG KRAPDLGWRM TDAWLSMAGA GSKGEPNGIP IDEWGIRMEA       300
     GSCNPAGASV TRGGAANGPA AVYAIRKWDE WLRKYAPPGA ASYDFYQSLP ALAQGNVAQQ       360
     IFWYTAFTAD MVKPQSEGNN TVDGDGNPLW RMAPSPHGPY WEDGQKVGYQ DVGSWTILNS       420
     TPLDRAQAAW LYAQFVVSKT VDVKKSHVGL TFIRDSSVNH ESFSERAAKL GGLVEFYRSP       480
     DRVRWSPTGI NVPDYPKLAQ IWWQQIGDVN SGAFTPQEAM DRLAFEMDTV MARMQAADEA       540
     ANVYGGCGPR LNEEKDAEWW FANGGAKPKL DNEKPQGETV NYDELVARWA KN               592
//

If you have problems or comments...

PBIL Back to PBIL home page