(data stored in ACNUC7421 zone)

EMBL: CP000031.PE601

CP000031.PE601       Location/Qualifiers
FT   CDS             630272..631357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0610"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93925"
FT                   /db_xref="GOA:Q5LVT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT5"
FT                   /protein_id="AAV93925.1"
FT                   /translation="MAKITLSKLRHSYYPNPKTPDDYALKEIDLDWTDGGAYALLGPSG
FT                   CGKSTLLNIISGLLVPSEGRILFDGQDVTELPPDKRNIAQVFQFPVIYDTMTVYDNLAF
FT                   PLRNRGRDEATVRERVTAIAEMLELSDLLNRKAAHLSPDNKQKISMGRGLVRQDVNVVM
FT                   FDEPLTVIDPHLKWKLRSKLKELHQRVRATMIYVTHDQTEALTFADQVVVMQEGEVVQI
FT                   GTPVELFDRPAHTFVGHFIGSPGMNILPAEVSGGVAHFAGQAIPLEGPITAAPGARTEI
FT                   GIRPEFVSLGLSGLPATVTKVSDVGRHTVVECEVAGSRVNAIVTGSGPEKGAMVQLEFR
FT                   RDQTRLYADGWLASEAAEGAA"
     MAKITLSKLR HSYYPNPKTP DDYALKEIDL DWTDGGAYAL LGPSGCGKST LLNIISGLLV        60
     PSEGRILFDG QDVTELPPDK RNIAQVFQFP VIYDTMTVYD NLAFPLRNRG RDEATVRERV       120
     TAIAEMLELS DLLNRKAAHL SPDNKQKISM GRGLVRQDVN VVMFDEPLTV IDPHLKWKLR       180
     SKLKELHQRV RATMIYVTHD QTEALTFADQ VVVMQEGEVV QIGTPVELFD RPAHTFVGHF       240
     IGSPGMNILP AEVSGGVAHF AGQAIPLEGP ITAAPGARTE IGIRPEFVSL GLSGLPATVT       300
     KVSDVGRHTV VECEVAGSRV NAIVTGSGPE KGAMVQLEFR RDQTRLYADG WLASEAAEGA       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page