(data stored in ACNUC7421 zone)

EMBL: CP000031.PE602

CP000031.PE602       Location/Qualifiers
FT   CDS             631354..632217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0611"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon.; identified by similarity to PIR:T46751"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93926"
FT                   /db_xref="GOA:Q5LVT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT4"
FT                   /protein_id="AAV93926.1"
FT                   /translation="MKTEYQKAWFFVLPVLVLVAFNALIPMMTVVNYSVQETFGDNLFF
FT                   WQGLGWFEQILRSDRFHAALGRQFLFTFLILIIEVPLGIAIALSMPRKGFWVPVCLVLM
FT                   ALPMLIPWNVVGAMWNIFTLPDIGLLGYFLNHVMGINYDMTQDPLAAWITIVTMDVWHW
FT                   TSLVVLLSYAGLVSIPDAYYQAAKIDGASNWAVFRYIQLPKMKTVLTIAILLRFMDSFN
FT                   IYTEPFVMTGGGPGNSTTLLSIDLVKIALGQFDLGPAAAMSLIYFAITLLVSWLFYTLM
FT                   TKDDQN"
     MKTEYQKAWF FVLPVLVLVA FNALIPMMTV VNYSVQETFG DNLFFWQGLG WFEQILRSDR        60
     FHAALGRQFL FTFLILIIEV PLGIAIALSM PRKGFWVPVC LVLMALPMLI PWNVVGAMWN       120
     IFTLPDIGLL GYFLNHVMGI NYDMTQDPLA AWITIVTMDV WHWTSLVVLL SYAGLVSIPD       180
     AYYQAAKIDG ASNWAVFRYI QLPKMKTVLT IAILLRFMDS FNIYTEPFVM TGGGPGNSTT       240
     LLSIDLVKIA LGQFDLGPAA AMSLIYFAIT LLVSWLFYTL MTKDDQN                     287
//

If you have problems or comments...

PBIL Back to PBIL home page