(data stored in ACNUC7421 zone)

EMBL: CP000031.PE604

CP000031.PE604       Location/Qualifiers
FT   CDS             633026..633304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48242.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93928"
FT                   /db_xref="GOA:Q5LVT2"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT2"
FT                   /protein_id="AAV93928.1"
FT                   /translation="MLSWMAWTWPTALLFIGIFSAIGVLVVLEIRHPGGDARKGVLGLT
FT                   TTRGDRLFISLLGSSYIFLAWLGLVGLPLWVPLGLALAWGSFCFWKV"
     MLSWMAWTWP TALLFIGIFS AIGVLVVLEI RHPGGDARKG VLGLTTTRGD RLFISLLGSS        60
     YIFLAWLGLV GLPLWVPLGL ALAWGSFCFW KV                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page