(data stored in ACNUC7421 zone)

EMBL: CP000031.PE606

CP000031.PE606       Location/Qualifiers
FT   CDS             633777..634910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD73596.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97129"
FT                   /db_xref="GOA:Q5LVT0"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT0"
FT                   /protein_id="AAV97129.1"
FT                   /translation="MDGEVLLNAYLDLNLLLVAGVAIWSLLRWAVAKTRLGTAYMPQLR
FT                   LLNGLTVLLVASPLLAMAITTWIVAHPPNIPDLLVRQYLHGNVGLSASQFEALLGLRED
FT                   MVRALLAQHEVWAQVVAAAFLAGALFCTLHMGLSVLRLSNSLRGAHLWKRIGRVHLLVS
FT                   DTARVAYSTRGLRNRYVVLPSALLEAPQDLRMTVAHELQHFRQSDIECEFLLELLRPLL
FT                   FWNPAFFLWRRQVRMLREYACDQALMARPHFDMRAYCECLFRACRVAAQNRVLFARTTP
FT                   TVALVDRRETRRPSTLHSRIEALTATRQDTAGPTAWLLISGLLVASVLSTMLVMQRSSD
FT                   WSHDRIMLSTIVNLERMAQRNATVASPFQGGFVVATD"
     MDGEVLLNAY LDLNLLLVAG VAIWSLLRWA VAKTRLGTAY MPQLRLLNGL TVLLVASPLL        60
     AMAITTWIVA HPPNIPDLLV RQYLHGNVGL SASQFEALLG LREDMVRALL AQHEVWAQVV       120
     AAAFLAGALF CTLHMGLSVL RLSNSLRGAH LWKRIGRVHL LVSDTARVAY STRGLRNRYV       180
     VLPSALLEAP QDLRMTVAHE LQHFRQSDIE CEFLLELLRP LLFWNPAFFL WRRQVRMLRE       240
     YACDQALMAR PHFDMRAYCE CLFRACRVAA QNRVLFARTT PTVALVDRRE TRRPSTLHSR       300
     IEALTATRQD TAGPTAWLLI SGLLVASVLS TMLVMQRSSD WSHDRIMLST IVNLERMAQR       360
     NATVASPFQG GFVVATD                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page