(data stored in ACNUC7421 zone)

EMBL: CP000031.PE611

CP000031.PE611       Location/Qualifiers
FT   CDS             639826..641367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0621"
FT                   /product="ankrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93934"
FT                   /db_xref="GOA:Q5LVS5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS5"
FT                   /protein_id="AAV93934.1"
FT                   /translation="MTKSLDQLRRDAKALGKAVADGDKGARLRVQGILTDPKQGSYKHA
FT                   DFLHVIARETGFATWPALKLAVETEGMDRAQKQGRLRWALYNGSPMTVNHLLREDPSLP
FT                   EGQVPLLVALYDVEGMREILARDPDAATRDYPPRRPMCHLAFSKHIKSQPEKQADMLAM
FT                   ADLLLAHGANVNDSFPSAPDTDHRLSALYGAIGHADNPALARWLLEHGADPNDNESLYH
FT                   STECGHVESLRLLLTHGANPMGTNALPRAIDFDNTEMVRLLLEHGANPNEGSSPHPSGE
FT                   PTLVIPALHQAARRLASAEIAQLLLQHGADPSARNRGHTPYAFARVFGNTAVAEVLEQA
FT                   GARTDLTVPEEILVRAADGTNSTHDRIDMQQIPEEMKYLLCRLVWREGTLAHMQRLVAM
FT                   GFDPNSPDEMGMPPLHLAGWEGMTEVMAYFLEQSPDLDHINEYGGTLLSTIVHGSENCP
FT                   QRHRRDHIECARMALERGVELPQKAATYATVPEMSAFLADWAESHPSQVVVHGVV"
     MTKSLDQLRR DAKALGKAVA DGDKGARLRV QGILTDPKQG SYKHADFLHV IARETGFATW        60
     PALKLAVETE GMDRAQKQGR LRWALYNGSP MTVNHLLRED PSLPEGQVPL LVALYDVEGM       120
     REILARDPDA ATRDYPPRRP MCHLAFSKHI KSQPEKQADM LAMADLLLAH GANVNDSFPS       180
     APDTDHRLSA LYGAIGHADN PALARWLLEH GADPNDNESL YHSTECGHVE SLRLLLTHGA       240
     NPMGTNALPR AIDFDNTEMV RLLLEHGANP NEGSSPHPSG EPTLVIPALH QAARRLASAE       300
     IAQLLLQHGA DPSARNRGHT PYAFARVFGN TAVAEVLEQA GARTDLTVPE EILVRAADGT       360
     NSTHDRIDMQ QIPEEMKYLL CRLVWREGTL AHMQRLVAMG FDPNSPDEMG MPPLHLAGWE       420
     GMTEVMAYFL EQSPDLDHIN EYGGTLLSTI VHGSENCPQR HRRDHIECAR MALERGVELP       480
     QKAATYATVP EMSAFLADWA ESHPSQVVVH GVV                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page