(data stored in ACNUC9435 zone)

EMBL: CP000031.PE613

CP000031.PE613       Location/Qualifiers
FT   CDS             complement(642985..643533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0623"
FT                   /product="cytochrome c oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97112"
FT                   /db_xref="GOA:Q5LVS3"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS3"
FT                   /protein_id="AAV97112.1"
FT                   /translation="MVQSIFFLFCLILAPLVAHLRQWSPTALFAVATLVYAAFGGANFV
FT                   STQIVLSNIRETEPAYRDTYYVVNRGYVSLNLGLAMAVFAVLTWLQTRFGAMLYPKITK
FT                   ALFWLLHLGLIGGSAFSTMLVFLLPKPRRFIDYPEFMETFILVGSWATLISSIAVLGLL
FT                   GLLVWSSALTWLASRNSGH"
     MVQSIFFLFC LILAPLVAHL RQWSPTALFA VATLVYAAFG GANFVSTQIV LSNIRETEPA        60
     YRDTYYVVNR GYVSLNLGLA MAVFAVLTWL QTRFGAMLYP KITKALFWLL HLGLIGGSAF       120
     STMLVFLLPK PRRFIDYPEF METFILVGSW ATLISSIAVL GLLGLLVWSS ALTWLASRNS       180
     GH                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page