(data stored in ACNUC7421 zone)

EMBL: CP000031.PE614

CP000031.PE614       Location/Qualifiers
FT   CDS             complement(643540..644166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B75629"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93936"
FT                   /db_xref="GOA:Q5LVS2"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS2"
FT                   /protein_id="AAV93936.1"
FT                   /translation="MRKYGRPYHLPTSPGVMSDDKILRDLSVLTAATEVVFTEKMDGEN
FT                   TTIYQGGCHARSPDSGYHASRDWMKAFAAVISPSLAENERIVGEYLFARHSVAYDNLNS
FT                   YFLGFAWIVDGTVKTWDSTVERFNILGIQPVSVLHRGSFSDAAVNAVLADLDLSKQEGF
FT                   VVRTTSEFSETNMGTCMAKYVRADHVQSETHWMNAEITRNGLKKA"
     MRKYGRPYHL PTSPGVMSDD KILRDLSVLT AATEVVFTEK MDGENTTIYQ GGCHARSPDS        60
     GYHASRDWMK AFAAVISPSL AENERIVGEY LFARHSVAYD NLNSYFLGFA WIVDGTVKTW       120
     DSTVERFNIL GIQPVSVLHR GSFSDAAVNA VLADLDLSKQ EGFVVRTTSE FSETNMGTCM       180
     AKYVRADHVQ SETHWMNAEI TRNGLKKA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page