(data stored in ACNUC9435 zone)

EMBL: CP000031.PE618

CP000031.PE618       Location/Qualifiers
FT   CDS             complement(652364..652888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93939"
FT                   /db_xref="GOA:Q5LVR9"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR9"
FT                   /protein_id="AAV93939.1"
FT                   /translation="MTSFNSFMRPLAAAILSALVTLAPVAPQAQEAVRGAVTNLPIPRF
FT                   VSMKANEGNVRRGPSLTHRIDWVFKRRDMPLQITAEHGHWRKVQDRDGAGGWVHYALLS
FT                   GVRTVLVEKDMMPLYARPDPASQVAAHFEMGVVARLGTCTQDWCRISAGGYRGWAPKEN
FT                   LWGVGTDEIRE"
     MTSFNSFMRP LAAAILSALV TLAPVAPQAQ EAVRGAVTNL PIPRFVSMKA NEGNVRRGPS        60
     LTHRIDWVFK RRDMPLQITA EHGHWRKVQD RDGAGGWVHY ALLSGVRTVL VEKDMMPLYA       120
     RPDPASQVAA HFEMGVVARL GTCTQDWCRI SAGGYRGWAP KENLWGVGTD EIRE             174
//

If you have problems or comments...

PBIL Back to PBIL home page