(data stored in ACNUC7421 zone)

EMBL: CP000031.PE622

CP000031.PE622       Location/Qualifiers
FT   CDS             657753..660260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0635"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93943"
FT                   /db_xref="GOA:Q5LVR5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR5"
FT                   /protein_id="AAV93943.1"
FT                   /translation="MKTQVKALVVGGGAVGTSIAYHLAKAGWNDVMLIERDELTSGSTW
FT                   HAAGLLPLFNMSYATTHIHQYSVDFYKTLEEETGLNAGFAVVGNLRMAQTQDRMDEYML
FT                   YASTAETCGVKYEWLTPDQIKERWPLIETSDLKGAIYHTEDGYINPADVTQAMAKGARQ
FT                   RGVDIVRKMQADAFHWNGTHWEVTCTKMVEKGGNLVPSDEQVVITAEHVVTASGNHAQR
FT                   TAKLLGIKMPAIPVEHTFIVMDQDPELVKWREAGNPEHPVVRDADNESYAREERGGWIL
FT                   GIYEHGAPARFEYGVPDSFRADLFPLDLDRIADQYMAMAERVPSCAESGLKDDFNGPIC
FT                   YTPDGNPLVGPAPGLRNMWLAEGFSFGITAAGGTGYYLAQMMVDGEAEIDMASLDPKRY
FT                   SSNWMTTEFAARKNEECYSHVYILHHPDEEREACRPLRTAPAYDRQKALGAQFGFVNGW
FT                   ERPNYYGPLDAPENFDHDARSFRRGGWWQYAVEEAKAIRNGVGLIDATAFTKHVVKGPG
FT                   ATQFLDWFTCNKLPKVGRINLTYALTSAGTTRTEYTIVRNGENNYYIVSAGAWTEYDAD
FT                   FLRKAAEDKMEEFGYIEIQDVTTQWGVFAIAGPKSRDVLKEVIKDADPETALSNKRFPW
FT                   LSARQIELGMCPVNAIRVAYTGELGWELHHPIEMQRYLWDLLLAAGEKHGMKLVGARAQ
FT                   NWLRQEKSYRAFGTELGRDATPLEADLPRFVDLGKDFHGKAEMEAKGIRSKCCTLLIDG
FT                   PSDADPWGREALYTPEGARVGRLTSGGYSVAFEKSIGMGYVKPELAVEGTKLKVKMLDQ
FT                   LWDAVVTCDSPYDPKNETIRKDG"
     MKTQVKALVV GGGAVGTSIA YHLAKAGWND VMLIERDELT SGSTWHAAGL LPLFNMSYAT        60
     THIHQYSVDF YKTLEEETGL NAGFAVVGNL RMAQTQDRMD EYMLYASTAE TCGVKYEWLT       120
     PDQIKERWPL IETSDLKGAI YHTEDGYINP ADVTQAMAKG ARQRGVDIVR KMQADAFHWN       180
     GTHWEVTCTK MVEKGGNLVP SDEQVVITAE HVVTASGNHA QRTAKLLGIK MPAIPVEHTF       240
     IVMDQDPELV KWREAGNPEH PVVRDADNES YAREERGGWI LGIYEHGAPA RFEYGVPDSF       300
     RADLFPLDLD RIADQYMAMA ERVPSCAESG LKDDFNGPIC YTPDGNPLVG PAPGLRNMWL       360
     AEGFSFGITA AGGTGYYLAQ MMVDGEAEID MASLDPKRYS SNWMTTEFAA RKNEECYSHV       420
     YILHHPDEER EACRPLRTAP AYDRQKALGA QFGFVNGWER PNYYGPLDAP ENFDHDARSF       480
     RRGGWWQYAV EEAKAIRNGV GLIDATAFTK HVVKGPGATQ FLDWFTCNKL PKVGRINLTY       540
     ALTSAGTTRT EYTIVRNGEN NYYIVSAGAW TEYDADFLRK AAEDKMEEFG YIEIQDVTTQ       600
     WGVFAIAGPK SRDVLKEVIK DADPETALSN KRFPWLSARQ IELGMCPVNA IRVAYTGELG       660
     WELHHPIEMQ RYLWDLLLAA GEKHGMKLVG ARAQNWLRQE KSYRAFGTEL GRDATPLEAD       720
     LPRFVDLGKD FHGKAEMEAK GIRSKCCTLL IDGPSDADPW GREALYTPEG ARVGRLTSGG       780
     YSVAFEKSIG MGYVKPELAV EGTKLKVKML DQLWDAVVTC DSPYDPKNET IRKDG            835
//

If you have problems or comments...

PBIL Back to PBIL home page