(data stored in ACNUC7421 zone)

EMBL: CP000031.PE623

CP000031.PE623       Location/Qualifiers
FT   CDS             complement(660313..660849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0636"
FT                   /product="EF hand domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93944"
FT                   /db_xref="GOA:Q5LVR4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR4"
FT                   /protein_id="AAV93944.1"
FT                   /translation="MMRIRRAGAPPAAKWPDGSGRIARLTCECRQTGVTLMRLLLLASA
FT                   CALGTAALAQGAPGAHFIENWDMDGDALISAAEIVEKRGEIFVMFDQNEDGALDTAEYD
FT                   LFDETRRADIEANAGGRKGPMALVDQAMDRAFNDADGDGLVSAEEFTAKSAAFFDMLDK
FT                   NGDGVISSADFKPGG"
     MMRIRRAGAP PAAKWPDGSG RIARLTCECR QTGVTLMRLL LLASACALGT AALAQGAPGA        60
     HFIENWDMDG DALISAAEIV EKRGEIFVMF DQNEDGALDT AEYDLFDETR RADIEANAGG       120
     RKGPMALVDQ AMDRAFNDAD GDGLVSAEEF TAKSAAFFDM LDKNGDGVIS SADFKPGG         178
//

If you have problems or comments...

PBIL Back to PBIL home page