(data stored in ACNUC7421 zone)

EMBL: CP000031.PE625

CP000031.PE625       Location/Qualifiers
FT   CDS             complement(661052..661669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAO90814.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93946"
FT                   /db_xref="GOA:Q5LVR2"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR2"
FT                   /protein_id="AAV93946.1"
FT                   /translation="MEQATRKARMLDKSQKPTWTSFEEATQADWDAVMEYEEAYNAALP
FT                   ERILDAIRSLDEAWTPYPINRFQHCLQAATRAHADGAEDEIVVAALVHDVGDILSPYNH
FT                   GELAAAMMKPYVSEKCHWILQHHCVFQGYYYNHYWGGDRNARDKYRDSPYWEDARYFCH
FT                   EYDQCAFDPDYPTKPLEFFEPILRRVLSRGGGHMELNETAEG"
     MEQATRKARM LDKSQKPTWT SFEEATQADW DAVMEYEEAY NAALPERILD AIRSLDEAWT        60
     PYPINRFQHC LQAATRAHAD GAEDEIVVAA LVHDVGDILS PYNHGELAAA MMKPYVSEKC       120
     HWILQHHCVF QGYYYNHYWG GDRNARDKYR DSPYWEDARY FCHEYDQCAF DPDYPTKPLE       180
     FFEPILRRVL SRGGGHMELN ETAEG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page