(data stored in ACNUC9435 zone)

EMBL: CP000031.PE627

CP000031.PE627       Location/Qualifiers
FT   CDS             complement(662592..662927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0640"
FT                   /product="4-carboxymuconolactone decarboxylase domain/
FT                   alkylhydroperoxidase AhpD family core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93949"
FT                   /db_xref="GOA:Q5LVR0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR0"
FT                   /protein_id="AAV93949.1"
FT                   /translation="MSWNDKLAATRAGLRNLHGAIPDTARAFGALGKTVKEGGTLDFKT
FT                   KEFVALGISIASRCEPCISLHVEALVKAGASRAELSDVLAMSIQMGGGPSMMYAAKALE
FT                   CFDDLTG"
     MSWNDKLAAT RAGLRNLHGA IPDTARAFGA LGKTVKEGGT LDFKTKEFVA LGISIASRCE        60
     PCISLHVEAL VKAGASRAEL SDVLAMSIQM GGGPSMMYAA KALECFDDLT G                111
//

If you have problems or comments...

PBIL Back to PBIL home page