(data stored in ACNUC7421 zone)

EMBL: CP000031.PE628

CP000031.PE628       Location/Qualifiers
FT   CDS             complement(662996..663646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0641"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAP57703.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93948"
FT                   /db_xref="GOA:Q5LVQ9"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ9"
FT                   /protein_id="AAV93948.1"
FT                   /translation="MSRTPPSVASIATQGDGARMVAPAAERNMAALCDLLAQVARHQGR
FT                   ALELASGTGQHVSAFAARLPGLQWQPTEVDAQRRASIDAYCEALDTVAPAQELNATRPG
FT                   WGADWAGQDLVVLINLLHLISEGEAATLISEAAAALAPGGRLVIYGPFMRAGELTSEGD
FT                   ERFHAALTAQDPEIGYKDDFDIIDRMQEAGLELAEVVEMPANNLALIAEKPRI"
     MSRTPPSVAS IATQGDGARM VAPAAERNMA ALCDLLAQVA RHQGRALELA SGTGQHVSAF        60
     AARLPGLQWQ PTEVDAQRRA SIDAYCEALD TVAPAQELNA TRPGWGADWA GQDLVVLINL       120
     LHLISEGEAA TLISEAAAAL APGGRLVIYG PFMRAGELTS EGDERFHAAL TAQDPEIGYK       180
     DDFDIIDRMQ EAGLELAEVV EMPANNLALI AEKPRI                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page