(data stored in ACNUC7421 zone)

EMBL: CP000031.PE629

CP000031.PE629       Location/Qualifiers
FT   CDS             complement(663643..664713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0642"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93950"
FT                   /db_xref="GOA:Q5LVQ8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ8"
FT                   /protein_id="AAV93950.1"
FT                   /translation="MIDFLVIGGGIAGLSAGARLSAHGKVTVLEAEEALGYHASGRSAA
FT                   LFEQAYGKPAVVALNRASAAYHHTANGGYLTPRGLMLVGAADQAEAFQADIVDMEMTPV
FT                   SLDEARAMVPILNPETVVYTAYHAEAWDIDTDRLMQDFARVIRANGGAVLTRQRVSRIA
FT                   HGAVWQVEAGEVFEARNIVNAAGAWADQVAVMAGVAPIGLQPYRRSMARIPAPGGHDLS
FT                   GWPMLMGAGESWYAKPDAGKLIISPADADPVEPQDAWADDMVLAEGLARYQEMVTEEVT
FT                   RMDSNWAGLRSFAPDRVLVLGPDPDQRDFIWCAGQGGYGFQTSPAASQLLCDLVTGAAP
FT                   EIEARMVAQLRPERLR"
     MIDFLVIGGG IAGLSAGARL SAHGKVTVLE AEEALGYHAS GRSAALFEQA YGKPAVVALN        60
     RASAAYHHTA NGGYLTPRGL MLVGAADQAE AFQADIVDME MTPVSLDEAR AMVPILNPET       120
     VVYTAYHAEA WDIDTDRLMQ DFARVIRANG GAVLTRQRVS RIAHGAVWQV EAGEVFEARN       180
     IVNAAGAWAD QVAVMAGVAP IGLQPYRRSM ARIPAPGGHD LSGWPMLMGA GESWYAKPDA       240
     GKLIISPADA DPVEPQDAWA DDMVLAEGLA RYQEMVTEEV TRMDSNWAGL RSFAPDRVLV       300
     LGPDPDQRDF IWCAGQGGYG FQTSPAASQL LCDLVTGAAP EIEARMVAQL RPERLR           356
//

If you have problems or comments...

PBIL Back to PBIL home page