(data stored in ACNUC9435 zone)

EMBL: CP000031.PE631

CP000031.PE631       Location/Qualifiers
FT   CDS             665776..666201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC48747.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93952"
FT                   /db_xref="GOA:Q5LVQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ6"
FT                   /protein_id="AAV93952.2"
FT                   /translation="MSTSNIHPMASEHLPRYIVAADGSDYLFTVMAVFTVGLILLIGVG
FT                   YFTLHALPERMAHKNNHSQFQLVGILALLALFTHNNVFWVAAVLVAGFQIPDLAAPLRA
FT                   ISDAIRGLGKTEDQGNATPSERAPEPTPHPAAATEGH"
     MSTSNIHPMA SEHLPRYIVA ADGSDYLFTV MAVFTVGLIL LIGVGYFTLH ALPERMAHKN        60
     NHSQFQLVGI LALLALFTHN NVFWVAAVLV AGFQIPDLAA PLRAISDAIR GLGKTEDQGN       120
     ATPSERAPEP TPHPAAATEG H                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page