(data stored in ACNUC7421 zone)

EMBL: CP000031.PE64

CP000031.PE64        Location/Qualifiers
FT   CDS             complement(67637..68263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q8UJ48; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93395"
FT                   /db_xref="GOA:Q5LWL1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL1"
FT                   /protein_id="AAV93395.1"
FT                   /translation="MTNNLIAKAAIDRRLAEIVSPVIADLGYELVRIRLMSGKSTTLQI
FT                   MADKPDGGIEVDDCAAISNAVSATLDVEDPILDAYTLEVSSPGIDRPLTRLKDFEMFEG
FT                   YEAKIETTEMIDGRRRFRGELAGIEGNEVLINLDQNGETVTIGLEFDWLSDAKLVLTDD
FT                   LIKEMLRQRKAAGVLNEDQFDEIVEEAPETGATTMARDGSEEETK"
     MTNNLIAKAA IDRRLAEIVS PVIADLGYEL VRIRLMSGKS TTLQIMADKP DGGIEVDDCA        60
     AISNAVSATL DVEDPILDAY TLEVSSPGID RPLTRLKDFE MFEGYEAKIE TTEMIDGRRR       120
     FRGELAGIEG NEVLINLDQN GETVTIGLEF DWLSDAKLVL TDDLIKEMLR QRKAAGVLNE       180
     DQFDEIVEEA PETGATTMAR DGSEEETK                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page