(data stored in ACNUC9435 zone)

EMBL: CP000031.PE65

CP000031.PE65        Location/Qualifiers
FT   CDS             complement(68420..69241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0065"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93396"
FT                   /db_xref="GOA:Q5LWL0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL0"
FT                   /protein_id="AAV93396.1"
FT                   /translation="MTRIDRRALFASGAAAALLASAGMSLADRPRAGGSLRLAVPRDDS
FT                   LERIARGAVFDTLTEIAPDGTLRGELATGWQPDDSARVWSFDLREDVTFHDGTRFSASD
FT                   AAASLAEIGLAEALGPTRLRLELAEADPGLPFRLADTRFAITRAGGAVTPLEQANGTGC
FT                   YRVERAQDGRHFLGRKVVGHYKQGQAGWADTVEVIVIPDPAVRAEALRDGYVDVAALPL
FT                   PDGLRDRTRFRYHPSEDDMALAAAVSVGLPRQISSRSALDDGRLAERWWVG"
     MTRIDRRALF ASGAAAALLA SAGMSLADRP RAGGSLRLAV PRDDSLERIA RGAVFDTLTE        60
     IAPDGTLRGE LATGWQPDDS ARVWSFDLRE DVTFHDGTRF SASDAAASLA EIGLAEALGP       120
     TRLRLELAEA DPGLPFRLAD TRFAITRAGG AVTPLEQANG TGCYRVERAQ DGRHFLGRKV       180
     VGHYKQGQAG WADTVEVIVI PDPAVRAEAL RDGYVDVAAL PLPDGLRDRT RFRYHPSEDD       240
     MALAAAVSVG LPRQISSRSA LDDGRLAERW WVG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page