(data stored in ACNUC7421 zone)

EMBL: CP000031.PE69

CP000031.PE69        Location/Qualifiers
FT   CDS             complement(71558..72388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0069"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93400"
FT                   /db_xref="GOA:Q5LWM4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM4"
FT                   /protein_id="AAV93400.1"
FT                   /translation="MKTALLQLTSSDDPAANLDMVRGMVAEAAAQGARWVLTPEVTNCV
FT                   SNSTTRQREVLQHEEDDITLAGLRAQATELGIWLLIGSLGLKTHDADGRFANRSFMIGP
FT                   DGGIVARYDKIHMFDVQVTETETFRESANYRPGDRAVLAPTEFGTVGMTICYDLRFPHL
FT                   HAALAQAGATVLTVPAAFSPVTGAAHWESLLRARAIETGCWVLAPAQTGTHPNSRGKPR
FT                   RTHGHSLVVAPWGEVRIDAGSEPGIHIFDLDDTSVTEARRRVPSLTHKRAFDGP"
     MKTALLQLTS SDDPAANLDM VRGMVAEAAA QGARWVLTPE VTNCVSNSTT RQREVLQHEE        60
     DDITLAGLRA QATELGIWLL IGSLGLKTHD ADGRFANRSF MIGPDGGIVA RYDKIHMFDV       120
     QVTETETFRE SANYRPGDRA VLAPTEFGTV GMTICYDLRF PHLHAALAQA GATVLTVPAA       180
     FSPVTGAAHW ESLLRARAIE TGCWVLAPAQ TGTHPNSRGK PRRTHGHSLV VAPWGEVRID       240
     AGSEPGIHIF DLDDTSVTEA RRRVPSLTHK RAFDGP                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page