(data stored in ACNUC7421 zone)

EMBL: CP000031.PE7

CP000031.PE7         Location/Qualifiers
FT   CDS             complement(5683..6297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0007"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93338"
FT                   /db_xref="GOA:Q5LWF7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF7"
FT                   /protein_id="AAV93338.1"
FT                   /translation="MTRAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEP
FT                   EETEDTFVGNARIKAHAAARATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFL
FT                   MAMTRAHDALEAKSAPHPRLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGY
FT                   DPMFVPEGYDVTFAEMDRWEKNKISHRARAVEKFVKGCFGG"
     MTRAFDGDTL LIATHNKGKL EEMAHLLQPF GVKVVGAAEM NLPEPEETED TFVGNARIKA        60
     HAAARATGLP ALSDDSGITI DALDGAPGVY TADWAETGNG RDFLMAMTRA HDALEAKSAP       120
     HPRLAQFRCT LVLAWPDGHD EVFEGVAPGH LVWPIRGAAG FGYDPMFVPE GYDVTFAEMD       180
     RWEKNKISHR ARAVEKFVKG CFGG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page