(data stored in ACNUC7421 zone)

EMBL: CP000031.PE70

CP000031.PE70        Location/Qualifiers
FT   CDS             complement(72385..72645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0070"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93401"
FT                   /db_xref="GOA:Q5LWM3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM3"
FT                   /protein_id="AAV93401.1"
FT                   /translation="MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMI
FT                   QRAGGRRTVPQIFIDGQHVGGCDDLYALEQDGKLDPMLASR"
     MKPVEIYTSP LCGYCHAAKR LLDQKGIAFT EIDVLTNPKR KPEMIQRAGG RRTVPQIFID        60
     GQHVGGCDDL YALEQDGKLD PMLASR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page