(data stored in ACNUC7421 zone)

EMBL: CP000031.PE71

CP000031.PE71        Location/Qualifiers
FT   CDS             complement(72738..73466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0071"
FT                   /product="competence protein F, putative"
FT                   /note="identified by similarity to GB:AAK22815.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93402"
FT                   /db_xref="GOA:Q5LWM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM2"
FT                   /protein_id="AAV93402.1"
FT                   /translation="MWQQIQTAIETVYPPRCLGCGDLVTSDFGLCGKCWRDTPFIDGTV
FT                   CDSCGAPLPGARDGHRIECDDCMAHPRPWSDGRAALLYTGRARRMVLALKHGDRPELAR
FT                   PGGLWMARAAAPLLQPNMLIAPVPLHWSRLLRRRYNQSALLAQSVGRQTGLPVCPDLLV
FT                   RDRATPMLEGMSMTERAKTLSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQAC
FT                   LNAGADQVFVLVLARVTREA"
     MWQQIQTAIE TVYPPRCLGC GDLVTSDFGL CGKCWRDTPF IDGTVCDSCG APLPGARDGH        60
     RIECDDCMAH PRPWSDGRAA LLYTGRARRM VLALKHGDRP ELARPGGLWM ARAAAPLLQP       120
     NMLIAPVPLH WSRLLRRRYN QSALLAQSVG RQTGLPVCPD LLVRDRATPM LEGMSMTERA       180
     KTLSGAISVH PKRRHRLTAR KLLLIDDVMT SGATLAASAQ ACLNAGADQV FVLVLARVTR       240
     EA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page