(data stored in ACNUC7421 zone)

EMBL: CP000031.PE75

CP000031.PE75        Location/Qualifiers
FT   CDS             complement(75848..76474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0075"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein/Tat domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93406"
FT                   /db_xref="GOA:Q5LWL8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL8"
FT                   /protein_id="AAV93406.1"
FT                   /translation="MNFCVKVLLMVKKPTTLSTRRSFLVGAATALGTPALAQFTPEDPL
FT                   RPAPEPEAPVRRNTSSFRALDWRPYFSNTRNGAILVDTVSRALHYWSEDQSVYRLFPSS
FT                   VPLTDELTRRGRTSVIRKVVGPSWAPTPSMKKRNPEWPDYIPPGPDNPLGTHALYLSWK
FT                   YYRIHGTHDTRKIGRRSSNGCIGLYNEHISQLFDLTKVGTQVLLI"
     MNFCVKVLLM VKKPTTLSTR RSFLVGAATA LGTPALAQFT PEDPLRPAPE PEAPVRRNTS        60
     SFRALDWRPY FSNTRNGAIL VDTVSRALHY WSEDQSVYRL FPSSVPLTDE LTRRGRTSVI       120
     RKVVGPSWAP TPSMKKRNPE WPDYIPPGPD NPLGTHALYL SWKYYRIHGT HDTRKIGRRS       180
     SNGCIGLYNE HISQLFDLTK VGTQVLLI                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page