(data stored in ACNUC7421 zone)

EMBL: CP000031.PE78

CP000031.PE78        Location/Qualifiers
FT   CDS             complement(77723..78286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0078"
FT                   /product="ribosomal subunit interface protein, putative"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93409"
FT                   /db_xref="GOA:Q5LWN3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN3"
FT                   /protein_id="AAV93409.1"
FT                   /translation="MRYQISGKQIDIGAALQSHVQTELGEVVSKYAQRPTDAHVVFSRS
FT                   AHEYVCEATVHLSTGLTAQAKAHATEIYAAFDGCCEKMDKQLRRYKRRLKDHHKDRAEP
FT                   VELFGASSYILASEEPDAQSEPDSLQPMIVAEMETKIPSLSVGEAVMQMELAGAPVLVF
FT                   RNESKDGLNVVYRREDGNIGWIDP"
     MRYQISGKQI DIGAALQSHV QTELGEVVSK YAQRPTDAHV VFSRSAHEYV CEATVHLSTG        60
     LTAQAKAHAT EIYAAFDGCC EKMDKQLRRY KRRLKDHHKD RAEPVELFGA SSYILASEEP       120
     DAQSEPDSLQ PMIVAEMETK IPSLSVGEAV MQMELAGAPV LVFRNESKDG LNVVYRREDG       180
     NIGWIDP                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page